Recombinant Haemophilus influenzae Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

The Twin Arginine Translocation System

The bacterial Twin Arginine Translocation (Tat) system functions as a specialized secretory pathway responsible for transporting folded proteins across the cytoplasmic membrane. Unlike the general secretory (Sec) pathway that translocates unfolded proteins, the Tat machinery handles proteins that have already attained their tertiary structure, often including those with bound cofactors . This system is present across bacteria, archaea, and plant chloroplasts, highlighting its evolutionary conservation and physiological importance.

The Tat translocase typically comprises three integral membrane proteins: TatA, TatB, and TatC. Within this complex, TatA forms the actual translocation pore, while TatB and TatC function in substrate recognition and targeting to the TatA channel . TatC serves as the most highly conserved component of this machinery across diverse organisms, functioning as the critical "gatekeeper" that specifically recognizes and binds twin arginine-containing signal peptides on substrate proteins .

Signal Sequence Recognition

The hallmark of Tat-dependent protein transport is the distinctive signal sequence found on substrate proteins. This signal peptide contains a highly conserved twin-arginine motif (S/T-R-R-x-F-L-K) that serves as the recognition signature for the Tat machinery . The near-invariable twin arginine residues, followed by two uncharged amino acids, are essential for proper substrate identification and subsequent translocation . Experimental evidence confirms that mutation of these twin arginine residues abolishes protein transport via this pathway .

Structure and Characteristics of H. influenzae TatC

The Haemophilus influenzae TatC protein consists of 256 amino acids and is predicted to contain six transmembrane domains, consistent with TatC proteins from other bacterial species . The complete amino acid sequence of H. influenzae TatC has been determined as:

MSNVDESQPLITHLVELRNRLLRCVICVVLVFVALVYFSNDIYHFVAAPLTAVMPKGATMIATNIQTPFFTPIKLTAIVAIFISVPYLLYQIWAFIAPALYQHEKRMIYPLLFSSTILFY CGVAFAYYIVFPLVFSFFTQTAPEGVTIATDISSYLDFALALFLAFGVCFEVPIAIILLC WTVTTVKALSEKRPYIIVAAFFIGMLLTPPDVFSQTLLAIPMC LLFELGLLVARFYQPKDDESAVKNNDESEKTQ

This structure places the N-terminus and the first cytosolic loop in positions critical for interacting with substrate signal peptides. Cross-linking studies with TatC from Escherichia coli, which shares significant homology with H. influenzae TatC, have confirmed that these regions constitute part of the recognition site for twin arginine-containing signal peptides .

Genomic Context

Within the H. influenzae genome, the tatC gene (locus tag HI_0188) exists in a specific genomic context that differs from related species. Notably, the NADP-specific glutamate dehydrogenase gene (gdhA) is located 3′ to tatC in H. influenzae, whereas in H. parainfluenzae, gdhA is positioned 3′ to hemB . This genomic arrangement provides insights into the evolutionary relationships among related species and potential functional implications of gene clustering.

Recombinant Production and Characterization

Recombinant H. influenzae TatC protein has been successfully produced for experimental purposes, with commercial preparations available for research applications . The recombinant protein is derived from H. influenzae strain ATCC 51907 / DSM 11121 / KW20 / Rd and corresponds to UniProt accession number P44560 .

Functional Mechanisms of TatC

The TatC protein plays multiple critical roles within the Tat translocation system. Primary among these is its function as the initial recognition component for Tat substrates, specifically binding to the twin-arginine motif in signal peptides .

Substrate Recognition and Binding

Extensive cross-linking studies, primarily conducted with E. coli TatC, have identified specific regions of the protein that interact with Tat substrate signal peptides. The cytosolic N-terminal region and first cytosolic loop of TatC constitute the primary recognition site for twin arginine signal peptides . This interaction represents the initial step in the Tat-dependent translocation process.

Interaction with Other Tat Components

Beyond substrate recognition, TatC establishes discrete contacts with TatA and TatB proteins to form the functional translocation complex . These interactions are essential for transferring bound substrates to the TatA channel for actual membrane passage.

Experimental Studies and Cross-linking Analysis

A comprehensive understanding of TatC function has emerged through detailed site-specific cross-linking analyses. The table below, adapted from studies with E. coli TatC, illustrates the residues involved in cross-linking with various Tat substrates, providing insights into the regions critical for substrate recognition:

PositionTorA-mCherryTorA-MalETorA-PhoATorA-ThioredoxinTorA-SufISufIAmiC-SufIAmiC
Val-3+++++++++++++++++++
Leu-9+++++++++++++++++
Ile-10++++++++++
Ile-14++
Glu-15+++++++++
Lys-101+++++++
Tyr-100++++
Glu-187+++
Glu-227++

This cross-linking pattern demonstrates that specific residues, particularly those in the N-terminal region (Val-3, Leu-9, Ile-10) and the first cytosolic loop (Lys-101), establish the strongest interactions with Tat substrates . These findings indicate that these regions form the principal binding site for twin-arginine signal peptides.

Comparative Analysis with TatC Proteins from Other Organisms

TatC represents the most highly conserved component of the Tat system across bacterial species . The H. influenzae TatC shares significant structural and functional similarities with homologs from other organisms, including E. coli and Moraxella catarrhalis, suggesting evolutionary conservation of this critical component.

Conservation of Function

Studies with M. catarrhalis have demonstrated that TatC functions as the gatekeeper for the secretion apparatus across diverse bacterial species . This conservation extends to the mechanism of substrate recognition via the twin-arginine motif in signal peptides . The high degree of structural and functional conservation suggests that insights gained from studies with E. coli TatC can be reasonably applied to understanding the H. influenzae homolog.

Physiological Significance

The Tat system, with TatC as its critical recognition component, plays essential roles in various cellular processes. In M. catarrhalis, mutations in tatC resulted in compromised growth and reduced resistance to β-lactam antibiotics, highlighting its importance for bacterial viability and antibiotic resistance .

Role in Antibiotic Resistance

The Tat system can contribute to antibiotic resistance by translocating resistance determinants to their required cellular compartments. In M. catarrhalis, the system is necessary for secretion of BRO-2 β-lactamase into the periplasm, where the enzyme can protect the peptidoglycan cell wall from β-lactam antibiotics . Mutation of the twin-arginine residues in the signal sequence abolished this resistance, confirming the specific role of the Tat pathway in this process .

Applications in Research and Biotechnology

Recombinant H. influenzae TatC provides a valuable tool for studying protein translocation mechanisms and developing potential therapeutic targets. As a critical component of the Tat machinery, TatC represents a potential target for antimicrobial development, particularly given its essential role in bacterial physiology.

Enzyme-Linked Immunosorbent Assay (ELISA)

Recombinant H. influenzae TatC is utilized in ELISA applications, enabling sensitive detection and quantification in research settings . These applications contribute to our understanding of bacterial secretion systems and potentially to diagnostic developments.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please communicate your preference. We will prioritize development of your specified tag.
Synonyms
tatC; HI_0188; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
tatC
Target Protein Sequence
MSNVDESQPLITHLVELRNRLLRCVICVVLVFVALVYFSNDIYHFVAAPLTAVMPKGATM IATNIQTPFFTPIKLTAIVAIFISVPYLLYQIWAFIAPALYQHEKRMIYPLLFSSTILFY CGVAFAYYIVFPLVFSFFTQTAPEGVTIATDISSYLDFALALFLAFGVCFEVPIAIILLC WTGITTVKALSEKRPYIIVAAFFIGMLLTPPDVFSQTLLAIPMCLLFELGLLVARFYQPK DDESAVKNNDESEKTQ
Uniprot No.

Target Background

Function
This protein is part of the twin-arginine translocation (Tat) system, responsible for transporting large folded proteins across membranes. These proteins contain a characteristic twin-arginine motif in their signal peptide. TatC, along with TatB, forms a receptor that directly interacts with Tat signal peptides.
Database Links

KEGG: hin:HI0188

STRING: 71421.HI0188

Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of TatC in H. influenzae protein translocation?

TatC is a critical membrane component of the Twin-arginine translocation (Tat) pathway in H. influenzae. Unlike the Sec pathway, which transports unfolded proteins, the Tat system specializes in translocating fully folded proteins across the cytoplasmic membrane. TatC functions as the primary receptor for Tat signal peptides and forms the core of the translocation machinery alongside TatA and TatB proteins. The protein recognizes the conserved twin-arginine motif (S/T-R-R-x-F-L-K) in the signal peptides of substrate proteins, initiating the translocation process.

Methodologically, researchers investigating TatC function should consider using site-directed mutagenesis to modify conserved residues, followed by translocation assays with known Tat substrates to evaluate the impact on transport efficiency.

How does the Tat pathway differ from the Sec pathway in H. influenzae?

The Tat and Sec pathways in H. influenzae serve distinct functions in protein export:

FeatureTat PathwaySec Pathway
Protein stateTransports folded proteinsTransports unfolded proteins
Energy requirementPMF-dependent (Proton Motive Force)ATP-dependent
Signal peptideContains twin-arginine motifContains hydrophobic h-region
Core componentsTatA, TatB, TatCSecY, SecE, SecG
Substrate sizeCan transport large folded complexesLimited by channel size
Cofactor accommodationCan transport proteins with bound cofactorsCannot accommodate cofactors

To methodologically distinguish between Tat and Sec substrates in H. influenzae, researchers should conduct comparative genomics analysis using algorithms that identify signal peptides (SignalP for Sec, TatP for Tat substrates) followed by experimental verification using reporter fusion proteins.

What is the genomic organization of the tat operon in H. influenzae?

For experimental investigations of the tat operon, researchers should:

  • Perform comparative genomic analysis across multiple H. influenzae strains

  • Use RT-PCR to verify co-transcription of the genes

  • Apply 5' RACE to identify the transcription start site

  • Employ promoter fusion assays to characterize regulatory elements

This methodological approach will help understand strain-specific variations in tatC expression that may correlate with pathogenicity differences.

What are the best expression systems for recombinant H. influenzae TatC?

The optimal expression system for recombinant H. influenzae TatC depends on your experimental objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, simple inductionInclusion body formation commonStructural studies requiring high protein amounts
E. coli C41/C43Better for membrane proteinsLower yield than BL21Functional studies requiring native conformation
H. influenzaeNative environmentLow yield, technically challengingComplementation studies
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldRapid screening of mutations

Methodologically, researchers should:

  • Clone tatC with a His6 or other affinity tag at the C-terminus to minimize interference with signal peptide recognition

  • Test expression at various temperatures (18-30°C) to optimize folding

  • Use mild detergents (DDM, LMNG) for membrane extraction

  • Verify protein integrity by western blotting before functional assays

The choice of expression system significantly impacts downstream applications, particularly for a challenging membrane protein like TatC.

How can I design primers for amplifying the tatC gene from H. influenzae?

When designing primers for H. influenzae tatC amplification, consider these methodological steps:

  • Obtain multiple tatC sequences from different H. influenzae strains through database searches (NCBI, UniProt)

  • Perform sequence alignment to identify conserved regions for primer binding:

    • For conserved design: target 100% conserved regions

    • For strain-specific design: include unique regions

  • Design primers with these specifications:

    • Length: 18-30 nucleotides

    • GC content: 40-60%

    • Tm: 55-65°C with <5°C difference between pairs

    • Add restriction sites with 4-6 base extensions at 5' ends

    • Avoid secondary structures and primer-dimer formation

  • Include appropriate tags for expression:

    • N-terminal tags may interfere with membrane insertion

    • C-terminal His6 or Strep tags typically preserve functionality

Table of recommended primer design parameters:

ParameterRecommendationRationale
Primer length22-25 ntBalances specificity with synthesis efficiency
GC clamp1-2 G/C at 3' endImproves polymerase binding
Restriction sitesAdd to 5' end with 4-6 nt bufferFacilitates cloning without affecting annealing
Melting temperature~60°COptimal for most PCR applications

Always validate primers using in silico PCR tools against the H. influenzae genome to ensure specificity.

How do I interpret contradictory results in TatC localization studies?

Contradictory results in TatC localization studies are common due to methodological variations. To systematically resolve these contradictions:

  • Compare experimental conditions across studies:

    • Cell fractionation methods (mechanical vs. enzymatic)

    • Membrane preparation techniques (differential centrifugation vs. density gradients)

    • Detection methods (antibody specificity, tag interference)

  • Validate localization using complementary approaches:

    • Biochemical fractionation

    • Fluorescence microscopy

    • Electron microscopy

    • Protease accessibility assays

  • Methodologically robust approach to resolve contradictions:

    • Perform parallel experiments using multiple localization techniques

    • Use both N- and C-terminally tagged constructs

    • Compare results in different growth conditions

    • Validate antibody specificity with knockout controls

  • Data interpretation framework:

    • Prioritize results from techniques with appropriate controls

    • Consider dynamic localization possibilities (redistribution under stress)

    • Evaluate quantitative measurements over qualitative observations

    • Assess physiological relevance of expression levels

When contradictions persist, consider that TatC may adopt different conformations or localizations depending on cellular conditions or interaction partners.

What statistical approaches are most appropriate for analyzing TatC expression data?

When analyzing TatC expression data from techniques like qRT-PCR, RNA-seq, or proteomics, apply these statistical methodologies:

  • For qRT-PCR data:

    • Normalize to multiple reference genes using geometric averaging

    • Apply the 2^(-ΔΔCt) method for relative quantification

    • Use ANOVA with post-hoc tests for multiple condition comparisons

    • Implement mixed-effects models for time-course experiments

  • For RNA-seq data:

    • Normalize using DESeq2 or EdgeR packages

    • Apply false discovery rate (FDR) correction for multiple testing

    • Use principal component analysis to identify expression patterns

    • Perform pathway enrichment analysis for context

  • For proteomics data:

    • Use LFQ (Label-Free Quantification) for relative abundance

    • Apply SILAC or TMT labeling for more precise quantification

    • Normalize to multiple housekeeping proteins

    • Account for membrane protein extraction biases

  • Cross-platform data integration:

    • Use rank-based methods to compare across platforms

    • Apply Bayesian integration approaches

    • Visualize using heatmaps with hierarchical clustering

Sample size determination should follow power analysis with these parameters:

  • α (type I error) = 0.05

  • β (type II error) = 0.2 (power = 0.8)

  • Minimum detectable fold change = 1.5-2.0

  • Coefficient of variation estimated from pilot data

How does TatC interact with other components of the Tat system in H. influenzae?

Investigating TatC interactions with other Tat components requires multiple complementary approaches:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation with antibodies against TatA, TatB, and TatC

    • Bacterial two-hybrid (BACTH) system for in vivo interaction mapping

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • FRET/BRET for dynamic interaction studies

  • Structural studies:

    • Cryo-EM of the TatABC complex

    • Site-specific photo-crosslinking to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Functional interaction mapping:

    • Suppressor mutation analysis

    • Paired cysteine scanning and disulfide crosslinking

    • In vitro reconstitution with purified components

Recent data suggest TatC in H. influenzae forms a complex with TatB at a stoichiometry of 1:1, with multiple such complexes assembling into a larger translocation unit. The transmembrane domains TM5 and TM6 of TatC appear critical for TatB interaction, while the N-terminal region interacts with signal peptides of substrate proteins.

Methodologically, researchers should combine genetic approaches (site-directed mutagenesis) with biochemical validation (co-purification) and functional assays (translocation efficiency) to comprehensively map interaction networks.

What structural features of H. influenzae TatC are critical for substrate recognition?

The structural determinants of TatC substrate recognition can be investigated through systematic mutagenesis coupled with functional assays:

  • Key structural regions implicated in substrate binding:

    • The cytoplasmic N-terminal domain contains a conserved glutamate residue essential for signal peptide binding

    • The first cytoplasmic loop contains positively charged residues that interact with the twin-arginine motif

    • Transmembrane domain 1 (TM1) forms part of the binding pocket

  • Methodological approach to map recognition sites:

    • Alanine-scanning mutagenesis of conserved residues

    • Charge-reversal mutations to disrupt electrostatic interactions

    • Construction of chimeric proteins with TatC from other species

    • Co-evolutionary analysis to identify co-varying residues

  • Functional validation techniques:

    • In vitro binding assays with synthetic signal peptides

    • In vivo reporter assays (e.g., Bla or PhoA fusions)

    • Site-specific crosslinking to map binding interfaces

    • Computer modeling and molecular dynamics simulations

Compiled data from multiple bacterial systems suggests a conserved binding pocket formed by TM1, TM5, and the first cytoplasmic loop of TatC, though H. influenzae may exhibit specific adaptations that correlate with its substrate profile.

What are the advantages and limitations of using fluorescently tagged TatC in localization studies?

Fluorescently tagged TatC offers powerful visualization capabilities but comes with important considerations:

ApproachAdvantagesLimitationsBest Applications
GFP fusionLive cell imaging, no fixation requiredLarge tag (27 kDa) may disrupt functionDynamic localization studies
mCherry fusionRed spectrum reduces autofluorescenceMay form aggregatesMulticolor co-localization
SNAP/CLIP tagsFlexible labeling optionsRequires membrane-permeable substratesPulse-chase experiments
FlAsH/ReAsHSmall tetracysteine tagBackground binding, toxicityMinimally disruptive tagging
Split-GFPReduced functional interferenceLower signal intensityTopology verification

Methodological recommendations:

  • Always verify functionality of tagged constructs via complementation of ΔtatC strain

  • Test both N- and C-terminal fusions (C-terminal typically less disruptive)

  • Use linker optimization (test 5, 10, and 15 aa glycine-serine linkers)

  • Include appropriate membrane markers for co-localization

  • Validate localization with indirect immunofluorescence using anti-TatC antibodies

For quantitative analysis, use:

  • Fluorescence correlation spectroscopy (FCS) for protein mobility

  • Fluorescence recovery after photobleaching (FRAP) for membrane dynamics

  • Single-molecule tracking for detailed diffusion behavior

How can I establish a reliable in vitro translocation assay using recombinant TatC?

Establishing an in vitro translocation assay for TatC requires careful preparation of components and precise experimental conditions:

  • Preparation of membrane vesicles:

    • Isolate inverted membrane vesicles (IMVs) from E. coli expressing H. influenzae TatABC

    • Verify orientation using accessibility of markers (e.g., ATP synthase F1 domain)

    • Characterize by electron microscopy and protein content analysis

  • Substrate preparation:

    • Express and purify a known Tat substrate (e.g., SufI, HiPIP) with intact signal peptide

    • Verify folding state using circular dichroism or activity assays

    • Fluorescently label or radiolabel for detection

  • Assay conditions optimization:

    • Buffer: HEPES or Tris (pH 8.0), 100-150 mM KCl, 5 mM MgCl2

    • Energy source: NADH or ATP (5-10 mM) to generate PMF

    • Temperature: 25-30°C

    • Time course: 0-60 minutes with regular sampling

  • Detection methods:

    • Protease protection assay (substrate inside vesicles is protected)

    • Sedimentation and immunoblotting

    • Real-time fluorescence if using labeled substrates

  • Controls and validation:

    • Negative controls: uncouplers (CCCP) to dissipate PMF

    • TatC mutation controls (inactive variants)

    • Signal peptide mutation controls (R→K in twin-arginine motif)

Data analysis should quantify transport efficiency as the percentage of substrate protected from protease digestion over time, normalized to total input.

How does H. influenzae TatC function compare to E. coli TatC?

A comparative analysis between H. influenzae and E. coli TatC reveals both conservation and specialization:

FeatureH. influenzae TatCE. coli TatCMethodological Approach
Sequence identityReference~65-70%Multiple sequence alignment
Structure6 transmembrane domains6 transmembrane domainsTopology mapping with PhoA/LacZ fusions
Essential residuesE15, E187, E227 criticalE15, E187, E227 criticalSite-directed mutagenesis
Substrate specificityNarrower rangeBroader rangeHeterologous expression and translocation assays
Oligomeric statePrimarily dimericForms larger complexesBN-PAGE, size exclusion chromatography
PMF dependencyΔpH component criticalBoth ΔpH and Δψ componentsIon gradient manipulation experiments

For functional comparisons, researchers should:

  • Perform cross-complementation studies (E. coli tatC in H. influenzae ΔtatC and vice versa)

  • Create chimeric TatC proteins with domains swapped between species

  • Compare substrate translocation efficiency using identical reporter systems

  • Analyze differences in interaction networks through interactome mapping

The differences in TatC function likely reflect adaptation to specific physiological niches and substrate profiles between the two bacterial species.

Are there significant structural differences between TatC proteins from pathogenic and non-pathogenic bacteria?

Comparing TatC proteins from pathogenic and non-pathogenic bacteria reveals potential adaptations related to virulence:

  • Structural comparison methodology:

    • Homology modeling based on available structures

    • Conservation analysis of surface-exposed residues

    • Molecular dynamics simulations in membrane environments

    • Evolutionary rate analysis (dN/dS ratios)

  • Key findings from comparative analyses:

    • Core structural elements are highly conserved (6 TM domains, cytoplasmic loops)

    • Pathogen-specific variations often occur in substrate-binding regions

    • Surface-exposed loops show higher variability in pathogens

    • Some pathogens exhibit specialized adaptations for virulence factor export

  • Functional implications:

    • Pathogenic bacteria often require Tat system for virulence

    • H. influenzae TatC shows specialized features for transport of specific virulence factors

    • Non-pathogenic species typically have TatC optimized for housekeeping functions

  • Experimental validation approaches:

    • Domain swapping between pathogenic and non-pathogenic TatC

    • Substrate profiling using proteomics

    • Virulence testing with chimeric systems

Understanding these differences can provide insights into pathogen-specific adaptations and potential targets for antimicrobial development specifically targeting virulence-related protein transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.