Recombinant Haemophilus influenzae Sensor protein qseC (qseC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qseC; HI_1707; Sensor protein QseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
qseC
Target Protein Sequence
MKNRSLTLRLISVLCLTALFVWLGSTLVAWWQVRHDVNKVFDAQQVLFAERLANSDLSTI LLESSTTLNKNSQSVLKKSYDDDALAFAIFSKTGKLLFSDGRNGKDFIFNYKTGFYNANI YDDDDKWRIFWRMAANGELVIAVGQELDYREDLIEEMILGQMWIWFASLPILIIVLGWLI HKELRPIKRLSQEVQTRKSGDVSLLNTEGLPVEILPLVKNLNQFFDRTSAMLQRERRFTS DAAHELRSPLAALRIQIEVAQLAGDDVALREQALLHLTQGIDRASQLIEQLLTLSRLDNL QALETLQLLDWEAIVQSLISERYFVAEKRKITLVFEKESEPKQKQGQSILVSLMLRNLLD NAIKYCPEDTIVSVKISSSQIIIEDNGGGVEPEDLKKLGQRFYRPAGQNEKGSGLGLSIV MRIAELHGFKVRLENVVKEGRRIGLKAIISL
Uniprot No.

Target Background

Function
A component of the two-component regulatory system QseB/QseC. It may activate QseB through phosphorylation.
Database Links

KEGG: hin:HI1707

STRING: 71421.HI1707

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the QseC protein and what is its function in Haemophilus influenzae?

QseC is a membrane-bound sensor kinase that functions as a bacterial adrenergic receptor in Haemophilus influenzae. It plays a crucial role in quorum sensing and interkingdom signaling by detecting both bacterial autoinducer-3 (AI-3) signals and host epinephrine/norepinephrine hormones. QseC activates transcription of virulence genes in response to these signals, making it a key component in bacterial pathogenesis and host-pathogen interactions . The full-length QseC protein consists of 451 amino acids and contains a periplasmic sensing domain that is conserved across multiple bacterial species, further highlighting its evolutionary significance in bacterial communication systems .

How is recombinant QseC protein typically expressed and purified for research applications?

Recombinant QseC protein is commonly expressed in E. coli expression systems with an affinity tag (typically His-tag) for purification purposes. According to available product specifications, full-length Haemophilus influenzae QseC protein (1-451 amino acids) can be expressed with an N-terminal His-tag in E. coli. The protein is typically purified to >90% purity as determined by SDS-PAGE . For functional studies, researchers must carefully consider protein reconstitution methods, as QseC is a membrane-bound sensor kinase that requires proper membrane integration to maintain its sensory and kinase activities. In experimental settings, QseC has been reconstituted into liposomes with an inside-out orientation (periplasmic domain inside liposomes, kinase domain outside) to study signal transduction and transmembrane signaling .

What is the recommended storage and handling procedure for recombinant QseC protein?

Recombinant QseC protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For long-term storage, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol (5-50% final concentration, with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity. For short-term usage, working aliquots can be stored at 4°C for up to one week. Prior to opening, vials should be briefly centrifuged to bring contents to the bottom . These careful handling procedures are essential for maintaining the structural integrity and functional activity of the protein for experimental applications.

How can researchers effectively reconstitute QseC into liposomes for functional studies?

To effectively reconstitute QseC into liposomes for functional studies, researchers should follow a protocol similar to that used in published studies on sensor kinases. First, purified QseC protein should be mixed with lipids (typically a mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin to mimic bacterial membranes) in detergent. The detergent is then gradually removed through dialysis or using adsorbent beads to allow liposome formation with incorporated protein.

When reconstituted properly, QseC typically adopts an inside-out orientation where the periplasmic sensing domain is inside the liposomes while the kinase domain faces outward. This orientation can be verified through antibody accessibility tests (if the protein contains tags like Myc) without disrupting the liposomes. The functional reconstitution can be confirmed by autophosphorylation assays, where ATP accessibility to the kinase domain without liposome disruption further validates the inside-out orientation . This system allows researchers to study signal transduction and transmembrane signaling mechanisms of QseC in response to various stimuli, including bacterial autoinducers and host hormones.

What methods are suitable for studying QseC-mediated signal transduction in vitro?

Several methodological approaches are effective for studying QseC-mediated signal transduction in vitro:

  • Autophosphorylation assays: Using purified QseC reconstituted into liposomes, researchers can measure autophosphorylation activity in response to signals like AI-3 and epinephrine/norepinephrine. This typically involves incubating the protein with [γ-32P]ATP and measuring incorporation of radiolabeled phosphate.

  • Phosphotransfer assays: Since QseC is part of a two-component signaling system, researchers can study the transfer of phosphate from QseC to its cognate response regulator (QseB) to understand signal propagation.

  • Ligand binding assays: Direct binding of signals (AI-3, epinephrine/norepinephrine) to QseC can be measured using techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or fluorescence-based assays with labeled ligands.

  • Inhibitor studies: Specific inhibitors like α-adrenergic antagonists (e.g., phentolamine) can be used to block QseC response to signals, providing insights into binding specificity and mechanism .

These approaches collectively allow researchers to dissect the molecular mechanisms of QseC signal recognition, transduction, and regulation in controlled in vitro conditions.

What are the recommended approaches for generating and characterizing qseC mutants?

For generating and characterizing qseC mutants, researchers can employ several complementary approaches:

  • CRISPR-based genome engineering: Using a two-plasmid system (pCas and pTargetF), researchers can insert specific N20 sequences targeting the qseC locus. This method has been successfully used to replace wildtype qseC with antibiotic resistance markers (e.g., chloramphenicol resistance gene, camR). The procedure typically involves transforming bacteria harboring pCas with homologous DNA template and pTargetF-qseC by electroporation, followed by selection on appropriate antibiotic-containing media .

  • Site-directed mutagenesis: For studying specific amino acid changes (e.g., L299R mutation), site-directed mutagenesis can be performed on cloned qseC genes.

  • Verification methods:

    • PCR amplification and sequencing to confirm mutations

    • Whole genome sequencing to ensure no off-target effects

    • Sanger sequencing for final confirmation of mutations

  • Phenotypic characterization:

    • Antimicrobial susceptibility testing (determining MICs for various compounds)

    • Biofilm formation assays (with and without antimicrobial peptide stress)

    • Virulence assessment in appropriate animal models

These approaches provide a comprehensive toolkit for investigating the functional consequences of qseC mutations in bacterial physiology, antimicrobial resistance, and virulence.

How does QseC contribute to antimicrobial peptide resistance in bacteria?

QseC plays a significant role in bacterial resistance to antimicrobial peptides through multiple mechanisms:

  • Direct impact of mutations: Specific mutations in the qseC gene, such as qseC(L299R), can significantly increase bacterial resistance to antimicrobial peptides. Research has shown that E. coli harboring the qseC(L299R) mutation exhibits 32 times higher resistance to membrane-disrupting agents like polymyxin B and colistin compared to wild-type strains .

  • Complete gene deletion effects: Deletion of the qseC gene (qseC::camR) also confers increased resistance to antimicrobial peptides, though the resistance level is typically lower than that observed with specific point mutations like qseC(L299R). This suggests that the presence of mutated QseC protein has different functional consequences than complete absence of the protein .

  • Biofilm formation mechanism: QseC mutations, particularly qseC(L299R), result in significantly higher biofilm production under antimicrobial peptide stress conditions. When bacteria with qseC mutations are exposed to sub-MIC levels of antimicrobial peptides like ALF Pm3, they produce substantially more biofilm than wild-type strains, potentially creating a protective barrier against these antimicrobials .

  • Early resistance mechanisms: Beyond biofilm formation (which typically develops later), qseC mutations also provide protection at early growth stages, suggesting alterations in membrane envelope properties that reduce susceptibility to cationic antimicrobial peptides. These early protection mechanisms are not fully characterized but may involve changes in membrane composition or surface charge .

Understanding these resistance mechanisms is crucial for developing strategies to combat antimicrobial resistance in clinical settings.

What is the relationship between QseC and bacterial virulence in vivo?

QseC plays a critical role in bacterial virulence in vivo through its function as a bacterial adrenergic receptor in interkingdom signaling:

  • Animal model evidence: Studies using rabbit infection models have demonstrated that qseC mutants are significantly attenuated for virulence compared to wild-type bacteria. This provides direct evidence for QseC's importance in pathogenesis within a host environment .

  • Virulence gene activation: QseC responds to both bacterial AI-3 signals and host epinephrine/norepinephrine hormones by activating transcription of various virulence genes. This activation is part of a coordinated virulence response that enhances bacterial pathogenicity during infection .

  • Signal integration function: QseC acts as an interface between bacterial communication (quorum sensing) and host stress hormone detection, allowing bacteria to sense and respond to the host environment. This interkingdom signaling capability enables bacteria to modulate their virulence in response to host physiological states .

  • Conservation across pathogens: The periplasmic sensing domain of QseC is conserved among several bacterial species, suggesting a common virulence regulation mechanism across different pathogens. This conservation highlights the evolutionary importance of this signaling system in bacterial pathogenesis .

These findings underscore the potential of QseC as a target for novel antimicrobial therapies that could disrupt bacterial virulence without directly killing bacteria, potentially reducing selective pressure for resistance development.

How does biofilm formation relate to QseC function under antimicrobial stress?

The relationship between QseC and biofilm formation under antimicrobial stress reveals complex adaptive mechanisms:

These findings highlight the multifaceted role of QseC in bacterial responses to antimicrobial stress and suggest that targeting QseC-mediated pathways could potentially overcome certain resistance mechanisms.

What is the mechanism of QseC sensing of both bacterial AI-3 and host hormones?

The dual-sensing capability of QseC for both bacterial AI-3 and host hormones (epinephrine/norepinephrine) involves specific molecular mechanisms:

  • Direct binding: QseC directly binds to both bacterial AI-3 signals and host epinephrine/norepinephrine hormones through its periplasmic sensing domain. This direct interaction has been demonstrated in reconstituted liposome systems .

  • Pharmacological inhibition: The binding of both AI-3 and epinephrine/norepinephrine to QseC can be specifically blocked by α-adrenergic antagonists such as phentolamine (PE). This pharmacological evidence suggests that the binding sites for these signals on QseC share structural similarities with eukaryotic adrenergic receptors, despite the evolutionary distance between these systems .

  • Signal-specific phosphorylation: Upon binding of these signals, QseC undergoes autophosphorylation, initiating a phosphorylation cascade that ultimately affects gene expression. The autophosphorylation activity can be measured in vitro and shows specificity to these signaling molecules .

  • Transmembrane signaling: The periplasmic sensing domain of QseC detects these signals in the external environment, and this information is transduced across the membrane to the cytoplasmic kinase domain through conformational changes in the membrane-intrinsic portions of the protein. This transmembrane signaling is crucial for connecting external signal detection to internal phosphorylation cascades .

Understanding this dual-sensing mechanism provides insights into bacterial adaptation strategies and potential targets for antimicrobial intervention that could disrupt both quorum sensing and interkingdom signaling.

How does the phosphorylation cascade initiated by QseC regulate bacterial gene expression?

The QseC-initiated phosphorylation cascade regulates bacterial gene expression through a complex signaling network:

  • Autophosphorylation initiation: Upon sensing AI-3 or epinephrine/norepinephrine, QseC undergoes autophosphorylation at a conserved histidine residue in its kinase domain using ATP as a phosphate donor .

  • Phosphotransfer to response regulator: The phosphoryl group from QseC is transferred to an aspartate residue in its cognate response regulator, QseB. This phosphotransfer activates QseB, allowing it to bind to specific DNA sequences and regulate gene transcription.

  • Virulence gene activation: Phosphorylated QseB activates the transcription of various virulence genes, including those involved in flagella and motility. This activation has been demonstrated by the observation that qseC mutants fail to activate expression of flagella and motility genes in response to AI-3, epinephrine, and/or norepinephrine .

  • Cross-talk with other signaling systems: The QseBC signaling system interacts with other two-component systems, particularly PmrAB, which has been implicated in biofilm formation. This cross-talk between different signaling systems allows for integrated regulation of complex bacterial responses to environmental stimuli .

  • Temporal regulation: The phosphorylation cascade allows for rapid response to environmental signals, providing bacteria with the ability to quickly adapt their gene expression patterns to changing conditions in the host environment.

This intricate regulation of gene expression through QseC-mediated phosphorylation enables bacteria to coordinate virulence factor production and survival mechanisms in response to both bacterial population density and host physiological states.

What structural features of QseC are critical for its function as a bacterial adrenergic receptor?

Several key structural features are essential for QseC's function as a bacterial adrenergic receptor:

  • Periplasmic sensing domain: The periplasmic domain of QseC is responsible for direct binding of both bacterial AI-3 and host epinephrine/norepinephrine. This domain is highly conserved among different bacterial species, indicating its evolutionary importance in signal recognition .

  • Transmembrane regions: QseC contains multiple transmembrane segments that anchor the protein in the bacterial membrane. These regions are critical for transmitting conformational changes from the periplasmic sensing domain to the cytoplasmic kinase domain upon signal binding .

  • Specific binding residues: Certain amino acid residues within the periplasmic domain are particularly important for signal recognition. For instance, the L299R mutation significantly alters QseC's function and confers increased resistance to antimicrobial peptides, suggesting this residue may be important for normal signal perception or response .

  • Kinase domain: The cytoplasmic kinase domain contains conserved motifs typical of histidine kinases, including the ATP-binding pocket and the histidine residue that becomes phosphorylated during signal transduction. This domain's proper function is essential for propagating the signal through phosphorylation .

  • Structural similarity to adrenergic receptors: Despite lacking significant sequence homology to eukaryotic adrenergic receptors, QseC's ability to bind epinephrine/norepinephrine and to be blocked by α-adrenergic antagonists suggests structural or functional similarities in the binding pocket. This convergent evolution represents a fascinating example of interkingdom signaling mechanisms .

Understanding these structural features provides potential targets for the development of novel antimicrobials that could specifically disrupt QseC signaling and attenuate bacterial virulence without directly killing bacteria.

What are the potential applications of QseC inhibitors in antimicrobial therapy?

QseC inhibitors show significant promise as novel antimicrobial therapeutics through several mechanisms:

  • Anti-virulence approach: Rather than killing bacteria directly, QseC inhibitors could attenuate bacterial virulence by disrupting the activation of virulence genes. This approach may exert less selective pressure for resistance development compared to conventional antibiotics .

  • Broad-spectrum potential: Given the conservation of the QseC periplasmic sensing domain across multiple bacterial species, inhibitors targeting this receptor could potentially have broad-spectrum activity against various pathogens that utilize this signaling system .

  • Existing pharmacological compounds: α-adrenergic antagonists like phentolamine have already been shown to block QseC response to both AI-3 and epinephrine/norepinephrine signals. These existing drugs, already approved for human use in other contexts, could potentially be repurposed as anti-virulence agents, accelerating the drug development timeline .

  • Combination therapy: QseC inhibitors could be used in combination with conventional antibiotics to enhance efficacy. By preventing biofilm formation (which is enhanced in qseC mutants under antimicrobial stress), these inhibitors might increase bacterial susceptibility to traditional antibiotics .

  • Resistance reversal: In bacteria that have developed resistance to antimicrobial peptides through qseC mutations, specific inhibitors targeting these mutant forms might restore sensitivity or prevent the protective mechanisms these mutations confer .

The development of QseC inhibitors represents a promising direction in the ongoing battle against antimicrobial resistance, offering alternative approaches to combat bacterial infections without directly threatening bacterial survival, which typically drives resistance evolution.

How can researchers effectively study QseC-mediated interkingdom signaling in complex host-pathogen models?

Studying QseC-mediated interkingdom signaling in complex host-pathogen models requires multifaceted approaches:

  • Advanced animal models: Beyond basic infection models, researchers can develop specialized animal models that allow for manipulation of host adrenergic signaling (through adrenergic agonists/antagonists or genetic approaches) to study the impact on bacterial virulence. Rabbit infection models have already demonstrated the importance of QseC in virulence in vivo .

  • Ex vivo organ/tissue systems: Using ex vivo intestinal epithelial cell cultures or organoids can provide controlled systems to study QseC-mediated host-pathogen interactions while maintaining tissue architecture and cellular diversity relevant to natural infections.

  • In vivo imaging techniques: Developing reporter systems that visualize QseC activation in real-time during infection could provide valuable insights into the temporal and spatial aspects of this signaling in vivo. This might involve constructing bacterial strains with fluorescent reporters downstream of QseC-regulated promoters.

  • Microbiome considerations: Since the gut microbiota produces AI-3 signals that activate QseC, incorporating microbiome analyses into host-pathogen studies is crucial. Gnotobiotic animal models with defined microbial communities could help dissect the contribution of specific microbial species to QseC signaling.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and metabolomics data from both the pathogen and host during infection can provide comprehensive insights into the global impact of QseC signaling on both organisms.

  • Drug inhibition studies: Using α-adrenergic antagonists like phentolamine in animal models can help validate the specific contribution of QseC signaling to pathogenesis in vivo .

These approaches collectively provide a robust framework for investigating the complex dynamics of QseC-mediated interkingdom signaling in physiologically relevant contexts.

What emerging technologies are most promising for studying QseC structure-function relationships?

Several cutting-edge technologies offer promising approaches for elucidating QseC structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): This technology has revolutionized membrane protein structural biology and could provide high-resolution structures of QseC in different conformational states, with and without bound ligands. Understanding these structural details would inform rational design of specific inhibitors.

  • AlphaFold and other AI-based structure prediction: These computational approaches can generate predicted structures of QseC and its domains, which can then guide experimental designs for validating key structural features and interactions.

  • Advanced lipidomics: Since QseC functions within the bacterial membrane, technologies that can analyze lipid-protein interactions could reveal how the membrane environment influences QseC conformation and function. This is particularly relevant given QseC's role in responding to membrane-disrupting antimicrobial peptides .

  • Single-molecule techniques: Methods such as single-molecule FRET (Förster Resonance Energy Transfer) could track conformational changes in QseC upon ligand binding in real-time, providing insights into the dynamics of signal transduction.

  • Nanobody development: Developing nanobodies that recognize specific conformational states of QseC could provide valuable tools for stabilizing particular states for structural studies and for probing function in vivo.

  • CRISPR-based high-throughput mutagenesis: Systematic mutation of residues throughout QseC, coupled with functional assays, could identify key amino acids involved in signal recognition, transmembrane signaling, and kinase activity.

  • Native mass spectrometry: This approach could provide insights into the oligomeric state of QseC and identify potential interaction partners in the bacterial membrane.

These technologies, especially when used in combination, have the potential to significantly advance our understanding of QseC's structural basis for dual sensing of bacterial and host signals and its role in antimicrobial resistance and virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.