Recombinant Haemophilus influenzae Thioredoxin-like protein HI_1115 (HI_1115)

What is the basic structure of the Thioredoxin-like protein HI_1115?

HI_1115 is a full-length (167 amino acids) thioredoxin-like protein from Haemophilus influenzae with the amino acid sequence: MKIKKLLKNGLSLFLTFIVITSILDFVRRPVVPEEINKITLQDLQGNTFSLESLDQNKPT LLYFWGTWCGYCRYTSPAINSLAKEGYQVVSVALRSGNEADVNDYLSKNDYHFTTVNDPK GEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRLFFAEFFG . The protein contains the characteristic thioredoxin fold with a WCGYCR motif that is essential for its thiol-disulfide exchange activity .

What are the conserved functional domains in HI_1115 and how do they compare to other thioredoxin family proteins?

The HI_1115 protein contains the highly conserved WCGYCR active site motif (residues 62-67) that is characteristic of thioredoxin family proteins . This region forms the catalytic center for thiol-disulfide exchange reactions. Unlike classical thioredoxins that typically have a WCGPC motif, HI_1115's WCGYCR variation suggests potential functional specialization. The protein likely maintains the canonical thioredoxin fold consisting of a central core of β-sheets surrounded by α-helices, similar to other thioredoxin family proteins that catalyze redox reactions through reversible oxidation of their active site dithiol .

What are the optimal conditions for expressing recombinant HI_1115 in E. coli?

For optimal expression of recombinant HI_1115 in E. coli, consider the following methodological approach:

• Vector selection: Balance copy number and promoter strength to minimize metabolic burden. High-copy plasmids (pMB1'-derived, 500-700 copies/cell) with moderate promoters or moderate-copy plasmids (p15A, ~10 copies/cell) with stronger promoters (like T7) can be effective .

• Expression strain: BL21(DE3) is recommended for T7 promoter-based expression as it contains the T7 RNA polymerase gene and lacks lon and ompT proteases .

• Induction conditions:

  • Temperature: 25-30°C post-induction often improves solubility

  • IPTG concentration: 0.1-0.5 mM for moderate induction

  • Induction time: 4-6 hours or overnight at lower temperatures

• Media composition: Rich media (LB, TB) supplemented with glucose (0.5-1%) to prevent leaky expression and additional amino acids may enhance protein yield .

This balanced approach prevents the negative effects of metabolic burden observed when high-copy vectors with strong promoters are used, which can decrease recombinant protein yields .

What purification strategy yields the highest purity and activity for recombinant HI_1115?

A multi-step purification strategy is recommended to achieve high purity and maintain activity:

• Affinity chromatography: For His-tagged HI_1115, use Ni-NTA agarose columns with the following buffer system:

  • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

  • Wash buffer: Same as binding buffer with 20-40 mM imidazole

  • Elution buffer: Same as binding buffer with 250-300 mM imidazole

• Size exclusion chromatography: Further purification using Superdex 75 in 20 mM Tris-HCl pH 8.0, 150 mM NaCl to remove aggregates and contaminants.

• Storage considerations: Store in Tris/PBS-based buffer with 50% glycerol at -20°C/-80°C. For working aliquots, store at 4°C for up to one week to avoid repeated freeze-thaw cycles which can compromise activity .

Protein purity should be assessed by SDS-PAGE (>90% purity is achievable) and activity should be confirmed using thioredoxin activity assays .

How can the redox activity of HI_1115 be accurately measured in experimental settings?

The redox activity of HI_1115 can be measured using several complementary approaches:

Method 1: DTNB Reduction Assay
This colorimetric assay measures the rate of reduction of 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) by thioredoxin:

• Reaction mixture (1 mL):

  • 100 mM potassium phosphate buffer, pH 7.0

  • 2 mM EDTA

  • 0.2 mM NADPH

  • 0.1 mM DTNB

  • Appropriate thioredoxin reductase (0.2 μM)

  • Purified HI_1115 (varying concentrations)

• Measurement: Monitor the increase in absorbance at 412 nm over time. The rate of TNB formation (ε₄₁₂ = 13,600 M⁻¹cm⁻¹) corresponds to the thioredoxin activity.

• Controls: Include reactions with known thioredoxin inhibitors to distinguish specific activity .

Method 2: Insulin Disulfide Reduction Assay
This assay measures the ability of HI_1115 to reduce insulin disulfide bonds:

• Reaction mixture:

  • 100 mM potassium phosphate, pH 7.0

  • 2 mM EDTA

  • 0.13 mM insulin

  • 1 mM DTT

  • Purified HI_1115

• Measurement: Monitor the increase in turbidity at 650 nm due to the precipitation of the free insulin B chain .

A standard activity curve should be prepared using known concentrations of a reference thioredoxin to ensure accurate quantification .

What experimental approaches can identify physiological protein targets of HI_1115 in Haemophilus influenzae?

To identify physiological protein targets of HI_1115, several complementary approaches can be employed:

In Vivo Single-Cysteine Mutant Approach:

• Generate a monocysteinic His-tagged HI_1115 mutant by substituting the resolving cysteine (likely Cys65 in the WCGYCR motif) with serine.

• Express this mutant in H. influenzae under physiological conditions.

• Extract proteins and purify using Ni-NTA chromatography.

• Elute covalently linked target proteins with DTT.

• Identify targets using mass spectrometry-based proteomics .

Transformed Recombinant Enrichment Profiling (TREP):
This technique uses natural transformation to generate pools of recombinants, followed by phenotypic selection and deep sequencing:

• Transform H. influenzae with DNA containing HI_1115 variants.

• Select for phenotypes of interest.

• Use deep sequencing to identify genetic variants associated with the phenotype .

Reductome Approach:

• Treat cell extracts with NEM to block free thiols.

• Add recombinant HI_1115 and DTT to reduce target proteins.

• Label newly exposed thiols with biotin-maleimide.

• Purify biotinylated proteins and identify by mass spectrometry .

The identified targets should be validated through direct binding assays and functional studies to confirm physiological relevance.

What is the role of HI_1115 in Haemophilus influenzae virulence and pathogenesis?

While the specific role of HI_1115 in H. influenzae virulence has not been fully characterized, thioredoxin-like proteins generally contribute to bacterial pathogenesis through several mechanisms:

• Oxidative stress defense: HI_1115 likely helps H. influenzae counter the oxidative burst from host immune cells by maintaining the reduced state of critical proteins. This function is particularly important during invasion and survival within epithelial cells and against neutrophil-mediated killing .

• Protein repair and homeostasis: By reducing inappropriate disulfide bonds formed during oxidative stress, HI_1115 may preserve the function of key virulence factors and metabolic enzymes required for infection.

• Potential interactions with host proteins: Like other bacterial thioredoxins, HI_1115 might interact with host proteins, potentially modifying host signaling pathways or redox-dependent processes. For example, H. influenzae uses surface proteins like Hsf to acquire host vitronectin, inhibiting complement activation and promoting intracellular invasion .

• Contribution to intracellular survival: Studies have identified H. influenzae factors like HMW1 that contribute to intracellular invasion and persistence during chronic infection. As a redox-active protein, HI_1115 potentially supports this process by helping bacteria cope with the intracellular environment .

Experimental approaches to verify these roles include creating HI_1115 knockout mutants and assessing their virulence in cellular infection models and animal studies.

How does HI_1115 interact with the host immune system during infection?

The interaction between HI_1115 and the host immune system likely involves several mechanisms, though direct evidence specific to HI_1115 is limited:

• Redox modulation of immune responses: As a thioredoxin-like protein, HI_1115 may contribute to modifying the redox environment at the host-pathogen interface. Many immune processes like neutrophil extracellular trap (NET) formation, inflammasome activation, and cytokine signaling are redox-sensitive.

• Protection against oxidative killing: During phagocytosis, H. influenzae encounters reactive oxygen species. HI_1115 likely participates in the bacterial defense system that neutralizes these oxidants and maintains the function of essential bacterial proteins .

• Potential role in biofilm formation: Biofilms provide protection against immune clearance, and redox regulation by thioredoxin-like proteins has been implicated in biofilm formation in other bacteria.

• Indirect effects through bacterial fitness: By maintaining the redox homeostasis of the bacterium, HI_1115 helps sustain the expression and function of direct virulence factors such as adhesins and invasins that engage with host immune components .

Research approaches to characterize these interactions include using recombinant HI_1115 in immune cell stimulation assays, comparing wild-type and HI_1115 mutant strains for survival in human serum, and assessing immune responses in infection models.

What controls should be included when studying HI_1115 activity in redox biochemistry experiments?

When designing experiments to study HI_1115 activity, the following controls are essential:

Positive Controls:

• Commercial thioredoxin with known activity (e.g., E. coli Trx1)

• Pre-reduced HI_1115 sample to establish maximum activity baseline

Negative Controls:

• Heat-inactivated HI_1115 (95°C for 10 minutes)

• Catalytic cysteine mutant (C62S in the WCGYCR motif)

• Reaction mixture without HI_1115

Specificity Controls:

• Thioredoxin inhibitors (e.g., PX-12 or auranofin) to confirm activity is thioredoxin-specific

• Non-redox related protein of similar size and charge

• Buffer-only control to account for spontaneous reactions

System Controls:

• Varying substrate concentrations to establish Km and Vmax

• pH range tests (typically pH 6.0-8.0) to determine optimal conditions

• Time course measurements to ensure linearity of the reaction

Data Recording Format:
Record your data in a structured table format like this:

This comprehensive control set ensures your results accurately reflect HI_1115-specific activity and helps identify potential experimental artifacts .

How should researchers design experiments to investigate potential synergistic interactions between HI_1115 and other redox proteins in Haemophilus influenzae?

To investigate potential synergistic interactions between HI_1115 and other redox proteins in H. influenzae, a systematic experimental design approach is necessary:

1. Proteomics-based interaction screening:

• Employ affinity-based techniques with single-cysteine HI_1115 mutants to trap interacting proteins

• Use crosslinking mass spectrometry to capture transient interactions

• Conduct co-immunoprecipitation experiments followed by mass spectrometry analysis

2. Functional interaction assays:

• Design a 3×3 factorial experiment testing combinations of purified HI_1115 with other redox proteins:

• Measure relevant endpoints such as:

  • Reduction of artificial substrates (DTNB, insulin)

  • Protection from oxidative stress in a cell-free system

  • Recycling efficiency of oxidized proteins

3. Genetic approach:

• Generate single, double, and triple gene knockouts in H. influenzae

• Measure phenotypic outcomes such as:

  • Sensitivity to oxidative stress (H₂O₂, paraquat)

  • Virulence in cell culture models

  • Metabolic fitness under various conditions

• Complement with wild-type and mutant variants to confirm specificity

4. Structural biology approach:

• Use protein-protein docking simulations to predict interaction interfaces

• Confirm predictions using site-directed mutagenesis of predicted interface residues

• Employ NMR or X-ray crystallography to solve structures of protein complexes

This multi-faceted approach will provide comprehensive evidence of functional interactions between HI_1115 and other redox proteins, potentially revealing new aspects of redox homeostasis in H. influenzae .

How can recombinant HI_1115 be utilized in developing new antimicrobial strategies against Haemophilus influenzae?

Recombinant HI_1115 can serve as a foundation for developing novel antimicrobial strategies through several approaches:

1. Target-based drug discovery:

• Use purified recombinant HI_1115 for high-throughput screening of compound libraries

• Identify small molecules that selectively inhibit HI_1115 activity

• Perform structure-activity relationship (SAR) studies to optimize lead compounds

• Verify efficacy of inhibitors against H. influenzae growth and virulence in vitro and in vivo

2. Structure-based drug design:

• Solve the crystal structure of HI_1115 using X-ray crystallography

• Identify unique structural features distinct from human thioredoxins

• Use computational approaches to design selective inhibitors targeting these differences

• Synthesize and test candidate molecules in enzyme and cellular assays

3. Immunological approaches:

• Develop antibodies against surface-exposed epitopes of HI_1115

• Test antibody-mediated neutralization of HI_1115 activity

• Assess potential for vaccine development using recombinant HI_1115 as an antigen

• Evaluate protection in animal models of H. influenzae infection

4. Combination therapy strategies:

• Determine if HI_1115 inhibition sensitizes H. influenzae to oxidative stress or antibiotics

• Design combination approaches targeting multiple redox systems simultaneously

• Test synergistic effects in antibiotic-resistant H. influenzae strains

Experimental validation table:

These approaches leverage recombinant HI_1115 as both a target and a tool for developing strategies that could overcome antibiotic resistance by exploiting bacterial redox vulnerabilities .

What are the methodological challenges in studying the evolutionary conservation of HI_1115 across Haemophilus species and other respiratory pathogens?

Studying the evolutionary conservation of HI_1115 across Haemophilus species and other respiratory pathogens presents several methodological challenges:

1. Sequence acquisition and alignment challenges:

• Incomplete genome annotations in many Haemophilus strains

• Presence of paralogous thioredoxin-like proteins confounding orthology assignment

• Varying nomenclature across databases hindering identification of true orthologs

• Low sequence conservation outside the active site complicating meaningful alignments

Approach: Use sensitive profile-based search methods (PSI-BLAST, HMM profiles) rather than simple BLAST. Employ phylogeny-aware multiple sequence alignment algorithms like MUSCLE or MAFFT with iterative refinement.

2. Functional conservation assessment:

• Biochemical divergence despite sequence similarity

• Different physiological roles in various species

• Context-dependent functionality based on other redox systems present

Approach: Develop a standardized activity assay panel to test recombinant proteins from multiple species. Use complementation studies by expressing HI_1115 orthologs in H. influenzae HI_1115 knockout strains.

3. Structural comparison limitations:

• Few solved structures for thioredoxin-like proteins from respiratory pathogens

• Difficulty in crystallizing membrane-associated or transient conformations

• Subtle structural differences with major functional implications

Approach: Combine homology modeling with targeted experimental structure determination of key representatives. Use molecular dynamics simulations to explore conformational flexibility.

4. Horizontal gene transfer (HGT) analysis:

• Confounding phylogenetic signals due to HGT events

• Recombination between closely related species creating chimeric sequences

• Different selection pressures in various host environments

Approach: Apply reconciliation methods that compare gene trees with species trees to identify HGT events. Use codon-based selection analyses to detect signatures of selection.

5. Data presentation and interpretation:

• Complex evolutionary patterns difficult to visualize

• Integration of sequence, structural, and functional data

Proposed data integration table:

This systematic approach provides a framework for addressing the complex methodological challenges in evolutionary studies of HI_1115, yielding insights into both conserved and divergent features across respiratory pathogens .

How should researchers interpret conflicting experimental results when characterizing HI_1115 function?

When faced with conflicting experimental results during HI_1115 characterization, researchers should employ a systematic troubleshooting and interpretation framework:

1. Methodological variation analysis:

• Compare experimental conditions across conflicting studies:

  • Buffer compositions (pH, ionic strength, reducing agents)

  • Protein preparation methods (tags, purification protocols)

  • Assay detection methods and their limitations

  • Temperature, time, and concentration differences

2. Statistical reassessment:

• Evaluate statistical power in each experiment

• Consider biological vs. technical replication strategies

• Apply appropriate statistical tests for the data type

• Consider Bayesian approaches to integrate prior knowledge with new data

3. Protein-specific considerations:

• Assess potential for oxidation state variability influencing activity

• Check for effects of freeze-thaw cycles on protein integrity

• Examine batch-to-batch variation in recombinant protein preparations

• Verify correct protein folding using circular dichroism or thermal shift assays

4. Systematic reconciliation approach:

• Create a decision matrix weighing evidence from various experiments:

5. Independent validation:

• Design critical experiments addressing specific conflicts

• Use orthogonal methods to test key hypotheses

• Consider blind experimental design to minimize bias

• Collaborate with laboratories using different approaches

6. Integration with broader knowledge:

• Compare with data from homologous proteins in related organisms

• Contextualize findings within known redox biochemistry principles

• Consider physiological relevance of in vitro observations

What are the most common pitfalls in designing experiments with recombinant thioredoxin-like proteins and how can they be avoided?

Working with recombinant thioredoxin-like proteins presents several common pitfalls that can compromise experimental outcomes. Here's a comprehensive guide to recognizing and avoiding these issues:

1. Oxidation state inconsistencies:

• Pitfall: Thioredoxins easily oxidize during purification, leading to variable activity in subsequent assays.

• Solution: Purify under reducing conditions (include 1-5 mM DTT or TCEP). Before activity assays, fully reduce an aliquot with excess DTT, then remove reductant using desalting columns in an anaerobic chamber or under nitrogen. Include redox state controls in all experiments .

2. Expression system artifacts:

• Pitfall: High-level expression can cause protein misfolding, inclusion body formation, or incorrect disulfide pairing.

• Solution: Optimize expression by tuning vector copy number and promoter strength. Consider specialized strains like Origami (DE3) for disulfide formation. Reduce induction temperature to 16-25°C. Validate protein folding using circular dichroism or thermal shift assays .

3. Tag interference:

• Pitfall: Affinity tags can alter protein activity, oligomerization, or interactions.

• Solution: Compare tagged and tag-cleaved variants. Position tags at both N- and C-termini to determine optimal configuration. Use smaller tags when possible. Include tag-only controls in interaction studies .

4. Buffer composition effects:

• Pitfall: Thioredoxin activity is sensitive to pH, ionic strength, and metal contamination.

• Solution: Systematically test buffer conditions. Include EDTA (0.1-1 mM) to chelate metal ions. Use high-quality, metal-free reagents. Document complete buffer compositions in publications .

5. Substrate specificity misinterpretation:

• Pitfall: Artificial substrates may not reflect physiological targets.

• Solution: Use multiple substrates and assay types. Validate with known thioredoxin substrates as positive controls. Develop physiologically relevant assays using potential natural substrates .

6. Data analysis errors:

• Pitfall: Improper normalization, baseline corrections, or kinetic analyses.

• Solution: Use appropriate enzyme kinetics models. Establish linear ranges for all assays. Include calibration curves with each experiment. Document all data processing steps .

Experimental design checklist to avoid common pitfalls:

By systematically addressing these common pitfalls, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant thioredoxin-like proteins like HI_1115.

What emerging technologies might enhance our understanding of HI_1115's role in bacterial redox homeostasis?

Several cutting-edge technologies show promise for elucidating HI_1115's role in bacterial redox homeostasis:

1. Redox-sensitive fluorescent probes and biosensors:

• Technology: Genetically encoded redox sensors (roGFP, HyPer) fused to target proteins

• Application: Real-time monitoring of HI_1115-mediated redox changes in living bacteria

• Advantage: Provides spatial and temporal resolution of redox events in single cells

• Implementation: Create H. influenzae strains expressing redox-sensitive reporters in wild-type and HI_1115 knockout backgrounds

2. CRISPR interference (CRISPRi) for dynamic expression control:

• Technology: Inducible dCas9-based repression of gene expression

• Application: Titrate HI_1115 expression levels to identify threshold effects on redox homeostasis

• Advantage: Allows temporal control and partial knockdown rather than complete knockout

• Implementation: Design guide RNAs targeting the HI_1115 promoter or coding region with varying efficiencies

3. Chemical genetics approaches:

• Technology: Small molecule modulators of protein function with temporal control

• Application: Probe HI_1115 function using selective inhibitors or activators

• Advantage: Rapid and reversible perturbation of protein function

• Implementation: Screen for compounds that specifically target HI_1115 using activity-based assays

4. Advanced mass spectrometry for thiol proteomics:

• Technology: Redox-specific chemical labeling coupled with quantitative proteomics

• Application: Comprehensive mapping of HI_1115-dependent changes in the bacterial thiol proteome

• Advantage: Identifies direct and indirect targets affected by HI_1115 activity

• Implementation: Compare thiol oxidation states in wild-type versus HI_1115 mutant strains under various stresses

5. Cryo-electron microscopy for structural dynamics:

• Technology: High-resolution structural analysis of protein complexes

• Application: Visualize HI_1115 interactions with partner proteins and conformational changes

• Advantage: Captures protein complexes in near-native states

• Implementation: Analyze HI_1115 complexes with substrate proteins in different redox states

6. Microfluidics and single-cell analysis:

• Technology: Droplet-based microfluidics coupled with single-cell sequencing

• Application: Examine heterogeneity in redox responses across bacterial populations

• Advantage: Reveals stochastic effects and subpopulation behaviors

• Implementation: Sort bacteria based on redox state, followed by transcriptomics or proteomics

7. Transformed Recombinant Enrichment Profiling (TREP):

• Technology: Combines natural transformation, phenotypic selection, and deep sequencing

• Application: Identify genetic interactions with HI_1115 that affect redox homeostasis

• Advantage: Discovers unexpected connections between redox systems and other cellular processes

• Implementation: Generate libraries of recombinants with varying HI_1115 alleles and select under oxidative stress conditions

These emerging technologies, when applied systematically, promise to revolutionize our understanding of HI_1115's role in bacterial redox homeostasis at molecular, cellular, and population levels.

How might advanced structural biology techniques reveal novel insights into the catalytic mechanism of HI_1115?

Advanced structural biology techniques can provide unprecedented insights into HI_1115's catalytic mechanism through multi-dimensional approaches:

1. Time-resolved X-ray crystallography:

• Technique: Synchrotron radiation or X-ray free-electron lasers (XFELs) for capturing short-lived reaction intermediates

• Expected insights: Visualization of transient conformational changes during catalysis

• Implementation strategy: Design crystal systems amenable to substrate diffusion or trigger reactions using light-sensitive reagents

• Key advantage: Captures the dynamic nature of catalysis beyond static structures

2. Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

• Technique: Measures solvent accessibility of protein regions through hydrogen/deuterium exchange rates

• Expected insights: Identifies conformational changes upon substrate binding and during catalysis

• Implementation strategy: Compare exchange patterns between wild-type HI_1115 and catalytic mutants with various substrates

• Key advantage: Provides dynamic structural information in solution without crystallization constraints

3. NMR spectroscopy of active site dynamics:

• Technique: Solution NMR with selective isotope labeling of active site residues

• Expected insights: Movement of catalytic cysteines during redox reactions

• Implementation strategy: ^13^C/^15^N labeling of specific residues (WCGYCR motif) to track chemical shift changes during catalysis

• Key advantage: Provides atomic-level dynamics in physiologically relevant conditions

4. Molecular dynamics simulations with quantum mechanics/molecular mechanics (QM/MM):

• Technique: Computational modeling combining quantum calculations for reactive centers with molecular mechanics for the protein environment

• Expected insights: Energetics of transition states and reaction intermediates not accessible experimentally

• Implementation strategy: Use experimental structures as starting points for simulations of the complete catalytic cycle

• Key advantage: Predicts energy barriers and reaction pathways to complement experimental observations

5. Cryo-electron microscopy of protein-protein complexes:

• Technique: Single-particle cryo-EM to determine structures of HI_1115 bound to substrate proteins

• Expected insights: Recognition motifs and interaction interfaces determining substrate specificity

• Implementation strategy: Stabilize complexes using single-cysteine mutants to form trapped mixed disulfides

• Key advantage: Reveals how HI_1115 recognizes and positions target proteins for catalysis

Integrative structural biology approach:
Combine these techniques in a complementary workflow:

This integrated approach would reveal not only what HI_1115 looks like but how it performs its catalytic function through coordinated structural dynamics, providing a comprehensive understanding of its redox biochemistry .