Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0036 (HI_0036)

Shipped with Ice Packs
In Stock

Description

Functional Context in Haemophilus influenzae

HI_0036 is part of the hitABC operon, which is associated with iron transport in H. influenzae . While its exact role is uncharacterized, ABC transporters in this pathogen typically mediate nutrient uptake (e.g., Fe³⁺ via hFbpABC) or drug efflux . Key functional inferences:

  • ATPase Activity: Utilizes ATP hydrolysis to power substrate translocation, a hallmark of ABC transporters .

  • Operon Association: Co-expressed with permease and substrate-binding proteins, suggesting a role in transmembrane transport .

  • Iron Metabolism: Potential indirect involvement in iron acquisition, a critical process for bacterial survival in host environments .

Expression and Purification

Recombinant HI_0036 is produced in two forms:

  1. Full-length protein: Expressed in E. coli with His tag, yielding >90% purity .

  2. Partial sequences: Expressed in baculovirus systems for specific research applications (e.g., ELISA) .

Reconstitution Guidelines:

  • Solubilize in sterile water (0.1–1.0 mg/mL).

  • Add 5–50% glycerol for long-term storage at -20°C/-80°C .

Mechanistic Insights from ABC Transporter Family

HI_0036 aligns with the ATP-switch model of ABC transporters :

  1. ATP Binding: Two ATP molecules bind at the interface of Walker A and LSGGQ motifs, inducing a closed dimer conformation .

  2. Substrate Translocation: Conformational changes in transmembrane domains (TMDs) switch accessibility from inward- to outward-facing states .

  3. Hydrolysis Cycle: ATP hydrolysis resets the transporter to its open state, completing the transport cycle .

Comparative studies with Salmonella typhimurium ABC transporters highlight conserved ATP-binding regions but divergent substrate specificities .

Research Applications

HI_0036 is commercially available for:

  • Antibody Development: Immunogen for generating anti-ABC transporter antibodies .

  • Structural Studies: Crystallization trials to resolve ATP-binding mechanisms .

  • Functional Assays: ATPase activity measurements or substrate transport reconstitution .

Product CodeApplicationSourcePrice
RFL24035HFFull-length proteinE. coliInquiry-based
CSB-BP701150HTA1Partial proteinBaculovirus1,960.00 €

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will then prepare the product according to your specific request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
HI_0036; Uncharacterized ABC transporter ATP-binding protein HI_0036
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0036
Target Protein Sequence
MDYSQEAITSLIWILQTLAITSVVFSFGIFLLVRFTQWGKQFWMFAGGYLSPKRSIKPIL FFLLIVAMTLLSVRISLVNSEWYKNMYTSLQEFNEHVFWQQMGLFCVIAASSVSAALVSY YLEQRFVINWIEWLNEQLVNKWMAHRAYYKTQYLSENLDNPDQRIQQDVQSYVKTTLSLS TGVIDAVTSMISYTILLWGLAGPMIVLGVEIPHMMVFLVFGYVIFTTLIAFWLGRPLISL NFINERLNANYRYSLIRIKEYAESIAFYAGEKVEKNQLYQQFNAVIHNMWVIIFRTLKFS GFNLVVSQISVVFPLLIQVGRYFEKQIKLGDLMQTLQVFGQLHANLSFFRSTYDNFASYK ATLDRLTGFCYAIEKANNKSQTQIHNHPTDVIFKNLSIQNPLGHTLIKHLNITLPQGTSL LIQGKSGAGKTTLLRTIAGLWSYAEGEINCPTHNQLFLSQKPYVPQGNLMSALAYPNNAD NISHTQAVEILNKVQLGHLAEQLEKEQDWTRILSLGEQQRLAFARLILHKPAVAFLDEAT ASMDEGLEFSMYQLLQQELPQTTIISVGHRSTLKTLHQQQLILQDKGQWQVL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0036

STRING: 71421.HI0036

Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Haemophilus influenzae HI_0036 ABC transporter protein?

The HI_0036 protein is an uncharacterized ATP-binding component of an ABC transporter system found in Haemophilus influenzae. It belongs to the superfamily of ABC (ATP-binding cassette) transporters that utilize ATP hydrolysis to transport substrates across cell membranes. The full-length protein consists of 592 amino acids and contains characteristic nucleotide-binding domains (NBDs) that are essential for ATP binding and hydrolysis . The protein sequence indicates it likely contains transmembrane domains (TMDs) that anchor the protein in the cell membrane, based on hydrophobicity analysis of its amino acid sequence which shows multiple hydrophobic segments consistent with membrane-spanning regions . ABC transporters in bacteria typically function in the import or export of various substrates including nutrients, lipids, and drugs across biological membranes.

How does HI_0036 compare to other characterized ABC transporters in H. influenzae?

HI_0036 appears to be distinct from the better-characterized hFbpABC Fe³⁺ transporter in H. influenzae, which is known to function in iron acquisition from host transferrin . While the hFbpABC system has been studied for its role in shuttling free Fe³⁺ through the periplasm and across the inner membrane, HI_0036 remains largely uncharacterized with respect to its specific substrate and transport mechanism .

Analysis of the amino acid sequence suggests HI_0036 contains features common to ABC transporters, including conserved ATP-binding motifs. Based on the topology prediction methods similar to those used for other ABC transporters, HI_0036 likely contains multiple transmembrane helices and at least one nucleotide-binding domain, which is consistent with either a half-size or full transporter configuration as seen in other bacterial ABC proteins .

What expression systems are optimal for producing recombinant HI_0036 protein?

For laboratory-scale production of recombinant HI_0036, Escherichia coli expression systems have proven effective. The recombinant protein can be successfully expressed in E. coli with an N-terminal His-tag to facilitate purification . This approach allows for straightforward isolation using affinity chromatography.

The expression protocol typically follows these methodological steps:

  • Clone the HI_0036 gene into an appropriate expression vector with a His-tag sequence

  • Transform the construct into a compatible E. coli strain (BL21(DE3) or similar)

  • Induce protein expression using IPTG at optimal concentration and temperature

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using Ni-NTA or similar affinity chromatography

  • Further purify using size exclusion chromatography if needed

Researchers should note that membrane proteins like ABC transporters can be challenging to express in soluble form, and optimization of expression conditions (temperature, induction time, detergent selection) may be necessary .

What are the critical storage conditions for maintaining HI_0036 protein stability?

The purified recombinant HI_0036 protein requires specific storage conditions to maintain stability and activity. Based on established protocols, the protein should be stored as follows:

  • The lyophilized protein powder should be stored at -20°C to -80°C upon receipt

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For buffer conditions, a Tris/PBS-based buffer at pH 8.0 with 6% trehalose is recommended

This storage protocol helps maintain protein integrity and prevents degradation that could compromise experimental results.

What experimental methods are recommended for determining the substrate specificity of HI_0036?

Determining the substrate specificity of uncharacterized ABC transporters like HI_0036 requires a multi-faceted experimental approach. Researchers should consider the following methodological strategies:

  • Genetic complementation assays: Express HI_0036 in ABC transporter-deficient bacterial strains and screen for restored phenotypes with various substrates.

  • Transport assays using radioactive or fluorescently labeled substrates: Monitor the uptake or efflux of labeled compounds in cells or membrane vesicles expressing HI_0036.

  • ATPase activity assays: Measure ATP hydrolysis rates in the presence of potential substrates, as substrate binding often stimulates ATPase activity.

  • Binding assays: Use techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to directly measure substrate binding.

  • Structural studies: Employ X-ray crystallography or cryo-EM to visualize substrate binding sites.

Based on the phylogenetic analysis approaches used for other ABC transporters, researchers should consider the possibility that HI_0036 may function in nutrient acquisition or drug efflux based on its sequence features and predicted membrane topology .

How can researchers distinguish ATP binding from ATP hydrolysis in the HI_0036 transporter?

Distinguishing between ATP binding and hydrolysis is crucial for understanding the mechanistic function of ABC transporters like HI_0036. Researchers should implement the following methodological approaches:

  • ATP binding assays:

    • Use non-hydrolyzable ATP analogs such as AMP-PNP or ATP-γ-S

    • Employ fluorescent ATP analogs (TNP-ATP) to monitor binding through changes in fluorescence

    • Conduct equilibrium dialysis with radiolabeled ATP ([γ-32P]-ATP)

  • ATP hydrolysis assays:

    • Measure inorganic phosphate release using colorimetric assays (malachite green)

    • Use coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) to monitor ADP production

    • Conduct direct ADP quantification using HPLC or LC-MS

  • Comparing binding and hydrolysis:

    • Analyze the effect of mutations in conserved Walker A and B motifs, which typically affect binding and hydrolysis differently

    • Study the impact of potential transport substrates on both binding affinity and hydrolysis rates

    • Compare ATPase activity in the presence of vanadate, which specifically inhibits the transition state of ATP hydrolysis

Understanding these distinct processes provides insight into the energy coupling mechanism of the HI_0036 transporter and its regulation.

What are the latest techniques for characterizing the membrane topology of HI_0036?

Characterizing the membrane topology of ABC transporters like HI_0036 requires specialized techniques to determine transmembrane segment organization. Contemporary methodological approaches include:

  • Computational prediction tools:

    • Use consensus prediction from multiple algorithms like TOPOCONS and TMPred, as applied to other ABC transporters

    • Implement hidden Markov model (HMM)-based approaches for transmembrane helix prediction

    • Apply evolutionary coupling analysis to identify residue contacts

  • Experimental validation methods:

    • Cysteine scanning mutagenesis combined with accessibility studies

    • Epitope insertion analysis with antibody accessibility determination

    • FRET-based distance measurements between strategically placed fluorophores

    • Site-directed crosslinking experiments to determine proximity relationships

  • Advanced structural approaches:

    • Cryo-electron microscopy for near-atomic resolution structures

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

    • Solid-state NMR spectroscopy for membrane protein structural analysis

By combining computational predictions with experimental validation, researchers can generate accurate topology models that inform functional studies of HI_0036.

What are the appropriate controls for HI_0036 functional assays?

When designing experiments to assess HI_0036 function, researchers should incorporate the following controls to ensure valid and interpretable results:

  • Negative controls:

    • Inactive protein variants: Express and purify HI_0036 with mutations in critical motifs (e.g., Walker A lysine to alanine mutation) to create ATPase-deficient controls

    • Empty vector controls: Cells expressing vector alone without the HI_0036 gene

    • ATPase inhibition: Include vanadate or other ATPase inhibitors to block ATP hydrolysis

  • Positive controls:

    • Well-characterized ABC transporters from H. influenzae with known function, such as components of the hFbpABC Fe³⁺ transporter system

    • Heterologous ABC transporters with similar predicted topology and function

  • Specificity controls:

    • Test structurally related but functionally distinct compounds to confirm substrate specificity

    • Include competitive and non-competitive inhibitors to validate transport mechanisms

    • Test ATP analogs to confirm nucleotide specificity

  • System controls:

    • Verify protein expression levels using Western blotting with anti-His antibodies

    • Confirm membrane localization using fractionation techniques

    • Validate protein folding using circular dichroism or limited proteolysis

Implementing these controls helps distinguish true functional characteristics from artifacts and provides a framework for robust data interpretation.

How should researchers interpret contradictory data regarding HI_0036 function?

When faced with contradictory data regarding HI_0036 function, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological reconciliation:

    • Compare experimental conditions including buffer composition, pH, temperature, and detergent usage

    • Evaluate protein preparation methods, focusing on differences in purification protocols

    • Assess the impact of tags (His-tag position and size) on protein function

    • Consider the influence of reconstitution systems (detergent micelles vs. liposomes vs. nanodiscs)

  • Analytical approach:

    • Create a comprehensive data table documenting all experimental variables across contradictory studies

    • Perform statistical analysis to identify significant variables affecting outcomes

    • Consider combining multiple analytical techniques to cross-validate findings

  • Biological considerations:

    • Examine potential post-translational modifications affecting protein function

    • Assess the impact of potential binding partners or accessory proteins

    • Consider conformational heterogeneity and its impact on function

  • Resolution strategies:

    • Design experiments specifically to test hypotheses explaining contradictions

    • Implement collaborations to reproduce experiments in different laboratories

    • Consider computational modeling to reconcile disparate experimental results

This structured approach helps transform contradictory data from a hindrance into an opportunity for deeper mechanistic understanding.

How does HI_0036 relate to other ABC transporters in bacterial pathogens?

To understand HI_0036 in the broader context of bacterial pathogen biology, comparative analysis with other ABC transporters provides valuable insights:

FeatureHI_0036hFbpABC (H. influenzae)ABC Drug Transporters (C. auris)
FunctionUncharacterizedFe³⁺ transportDrug efflux
Structure592 aa, TMDs + NBDPeriplasmic binding protein-dependentVariable TMD and NBD arrangements
Expression RegulationUnknownIron-responsiveDrug-inducible
Role in PathogenesisTo be determinedEssential for iron acquisition from hostAssociated with antifungal resistance
Conserved MotifsWalker A (GKSGAGKT)Walker A and B, ABC signatureWalker A and B, ABC signature
Substrate SpecificityUnknownFe³⁺Various drugs and toxins

Based on phylogenetic analysis approaches used for other ABC transporters, researchers can gain insight into potential functions by examining the relationship between sequence conservation and functional specialization . The expression patterns of ABC transporters in response to environmental stimuli, such as drug exposure in C. auris, provide a model for investigating HI_0036 regulation .

The relationship between HI_0036 and the well-characterized hFbpABC Fe³⁺ transporter system in H. influenzae may suggest complementary roles in metal homeostasis or distinct functions in nutrient acquisition .

What can be learned from studying HI_0036 orthologs in other bacterial species?

Investigating HI_0036 orthologs across bacterial species provides a powerful approach for functional prediction and evolutionary context:

  • Comparative genomics approach:

    • Identify orthologs using reciprocal BLAST searches and phylogenetic analysis

    • Examine gene neighborhood conservation to identify functionally related genes

    • Compare ortholog distribution with known phenotypic traits across species

  • Functional insights from characterized orthologs:

    • Leverage experimental data from well-studied orthologs in model organisms

    • Transfer functional annotations based on high sequence similarity

    • Identify unique sequence features that might indicate specialized functions

  • Evolutionary considerations:

    • Analyze selection pressure on different protein domains to identify functionally critical regions

    • Examine gene duplication events and subsequent functional divergence

    • Consider horizontal gene transfer events that might suggest adaptation to specific niches

  • Experimental validation strategies:

    • Test functional complementation across species

    • Compare substrate specificity profiles between orthologs

    • Examine regulatory differences in ortholog expression

This comparative approach allows researchers to leverage the collective knowledge across bacterial species to generate testable hypotheses about HI_0036 function.

What high-throughput screening approaches can identify potential inhibitors of HI_0036?

For researchers developing therapeutic strategies targeting HI_0036, systematic high-throughput screening approaches include:

  • Biochemical screening methodologies:

    • ATPase activity assays in 384 or 1536-well formats using colorimetric or fluorescent readouts

    • Thermal shift assays to identify compounds that stabilize or destabilize protein structure

    • Surface plasmon resonance screening for direct binding interactions

    • Fluorescence polarization assays with labeled ATP analogs

  • Cellular screening approaches:

    • Growth inhibition assays using H. influenzae strains with varying HI_0036 expression levels

    • Reporter gene assays linked to HI_0036 function

    • Membrane permeability assays using fluorescent substrates

    • Resistance development monitoring during compound exposure

  • Computational screening methods:

    • Structure-based virtual screening using homology models

    • Pharmacophore-based screening based on known ABC transporter inhibitors

    • Machine learning approaches integrating multiple data types

    • Molecular dynamics simulations to identify allosteric binding sites

  • Data analysis and hit validation:

    • Implement robust statistical methods for hit identification

    • Establish clear criteria for structure-activity relationships

    • Develop orthogonal assays for confirmation of primary hits

    • Assess selectivity against human ABC transporters

These methodological approaches enable efficient identification of compounds that specifically modulate HI_0036 function while minimizing false positives.

How can CRISPR-Cas9 technology be applied to study HI_0036 function in Haemophilus influenzae?

CRISPR-Cas9 technology offers powerful approaches for investigating HI_0036 function through precise genetic manipulation:

  • Gene knockout strategies:

    • Design guide RNAs targeting essential regions of the HI_0036 gene

    • Implement CRISPR interference (CRISPRi) for conditional knockdown

    • Create scarless deletions to avoid polar effects on adjacent genes

    • Develop complementation systems to validate phenotypes

  • Domain-specific modifications:

    • Introduce point mutations in conserved motifs (Walker A/B, ABC signature)

    • Create chimeric proteins by swapping domains with other ABC transporters

    • Add epitope tags or fluorescent proteins for localization studies

    • Engineer conditional degradation systems for temporal control

  • Regulatory element analysis:

    • Target promoter regions to understand expression control

    • Modify ribosome binding sites to modulate translation efficiency

    • Create reporter fusions to monitor expression under different conditions

    • Perform saturation mutagenesis of regulatory regions

  • Technical considerations for H. influenzae:

    • Optimize transformation protocols for CRISPR components

    • Develop appropriate selection markers for H. influenzae

    • Establish efficient homology-directed repair templates

    • Consider prophage-based delivery systems for difficult-to-transform strains

These CRISPR-based approaches enable precise genetic manipulation to dissect HI_0036 function in its native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.