Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preferred format in the order notes section, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles to maintain optimal protein stability.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Should you have a specific tag type requirement, please communicate it to us, and we will prioritize developing it according to your specifications.
Synonyms
HI_0663; Uncharacterized ABC transporter ATP-binding protein HI_0663
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-560
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0663
Target Protein Sequence
MLWNWVALVGGIISAVVFSYILQAAYFHELSLLSAVILGIVLIAALALRAFAGKKSVQAS YFASTKVKHELRSLIYRKLASMPLNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYS LLAPLTLFAFLIFFSFKTAIILLICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLD NLQGLITLKIYQDDAYKAKAMDKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILT ALLQFQNAQLSVLGVILFILLSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQ QSAVDFEAKNNVQVEIKDLHFSYSEEKPAITGLNLSILPNQLSVFVGKSGCGKSTLVSLL MGFNKAQQGEILFNGQNALNIDRTSFYQKVSLVSHSSYVFKGTLRENMTMAKIDATDEQI YACLEQVNLAQFVRDNGGLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNI DVESEEIILQFIQQFKQQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHKELMEKQGA YAEMFQQQKDLEQIREVANA
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0663m

STRING: 71421.HI0663m

Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HI_0663 and how is it classified within ABC transporters?

HI_0663 is an uncharacterized ATP-binding protein that belongs to the ATP-binding cassette (ABC) transporter superfamily found in Haemophilus influenzae. ABC transporters constitute a membrane protein superfamily that translocates various molecules across extra- and intra-cellular membranes by binding and hydrolyzing ATP to power the transport mechanism . In bacteria like H. influenzae, ABC transporters typically function in one of two ways: as importers that facilitate nutrient uptake (sugars, metal ions, vitamins) or as exporters that remove toxic substances, contributing to drug resistance mechanisms . While specific classification data for HI_0663 is limited in current literature, it possesses the characteristic nucleotide binding domain (NBD) responsible for ATP binding and hydrolysis that is highly conserved across ABC transporters . Commercial availability of recombinant HI_0663 protein indicates scientific interest in characterizing this specific transporter .

What structural features define HI_0663 compared to other bacterial ABC transporters?

Based on general ABC transporter architecture, HI_0663 likely contains the core structural elements typical of this protein family. The canonical structure includes a nucleotide binding domain (NBD) that binds and hydrolyzes ATP, coupled with transmembrane domains (TMDs) that create the substrate translocation pathway . The NBDs of ABC transporters are highly conserved and serve as the "engine" that drives conformational changes in the transporter through ATP binding and hydrolysis . In contrast, the TMDs typically consist of five to six α-helical segments with greater sequence and structural variability across different ABC transporters, reflecting their diverse substrate specificities . Without crystal structure data specific to HI_0663, researchers must rely on comparative analysis with better-characterized ABC transporters to predict structural features, though recombinant expression systems have made it possible to produce sufficient quantities of this protein for structural studies .

What expression systems are most effective for recombinant HI_0663 production?

For recombinant production of HI_0663, E. coli-based expression systems have proven effective, as evidenced by the commercial availability of His-tagged recombinant HI_0663 expressed in E. coli . Drawing from established protocols for other H. influenzae proteins, researchers might consider using T7 promoter-based expression systems, which have successfully produced high levels of recombinant H. influenzae proteins in previous studies . When working with ABC transporters like HI_0663, addressing the challenges of membrane protein expression is critical. Researchers have successfully employed strategies similar to those used for the H. influenzae lipoprotein e (P4), where N-terminal modification signal sequences were replaced with protein secretion signals lacking lipid modification, placing expression under control of the T7-inducible promoter . This approach facilitates easier extraction from bacterial membranes while maintaining key structural and functional properties comparable to the wild-type protein .

What purification protocols yield highest purity and activity for recombinant HI_0663?

Effective purification of recombinant HI_0663 likely requires a multi-step chromatography approach similar to protocols developed for other H. influenzae recombinant proteins. For membrane-associated proteins like ABC transporters, initial extraction using appropriate detergents is crucial for solubilization while preserving native structure and function . Affinity chromatography using His-tag technology provides an excellent first purification step, as seen in the commercially available His-tagged HI_0663 . Following affinity purification, researchers should consider employing gel filtration chromatography as a second step to achieve apparent homogeneity and separate any protein aggregates or impurities, a strategy that has proven effective for other H. influenzae recombinant proteins . Optimization of buffer conditions throughout the purification process is essential to maintain stability and activity of the recombinant protein. Assessment of protein purity can be performed using SDS-PAGE analysis, while activity assays specific to ATP binding and hydrolysis would confirm functional integrity of the purified HI_0663 protein .

How can researchers accurately measure ATP binding and hydrolysis activity of HI_0663?

To effectively measure ATP binding and hydrolysis activity of recombinant HI_0663, researchers should employ multiple complementary approaches. ATP binding can be assessed using fluorescent ATP analogs such as TNP-ATP (2′(3′)-O-(2,4,6-trinitrophenyl)adenosine 5′-triphosphate) in fluorescence spectroscopy experiments, which exhibit increased fluorescence upon binding to the nucleotide binding domain. Additionally, isothermal titration calorimetry (ITC) provides quantitative thermodynamic parameters of ATP binding, including binding affinity, stoichiometry, and enthalpy changes. For ATP hydrolysis activity, researchers typically utilize colorimetric assays that detect inorganic phosphate release, such as the malachite green assay or the more sensitive EnzChek Phosphate Assay. These methods should be performed under varying conditions to determine optimal pH, temperature, and divalent cation requirements for HI_0663 activity. When analyzing activity data, it's important to account for background ATP hydrolysis and ensure that observed activity is specifically attributed to the purified HI_0663 protein through appropriate controls, such as using ATP-binding deficient mutants generated through site-directed mutagenesis of conserved Walker A and B motifs within the nucleotide binding domain .

What methods can identify potential substrates transported by HI_0663?

Identifying substrates for uncharacterized ABC transporters like HI_0663 requires a multi-faceted approach combining computational prediction with experimental validation. Initially, researchers should employ bioinformatic analyses to compare sequence and structural features of HI_0663 with well-characterized ABC transporters of known function, particularly examining the transmembrane domains which typically determine substrate specificity . Computational approaches using tools that incorporate the 188D feature extraction method combined with Random Forest classification have demonstrated 89% accuracy in predicting ABC transporter function and substrate classes . Experimentally, researchers can reconstitute purified HI_0663 into proteoliposomes to create an in vitro transport system for direct measurement of substrate translocation. Substrate binding can be assessed through techniques such as fluorescence-based binding assays or surface plasmon resonance (SPR) using a panel of potential substrates based on known functions of ABC transporters in H. influenzae. Additionally, growth phenotype analysis of HI_0663 deletion or overexpression strains in the presence of various nutrients or toxic compounds can provide physiological evidence of substrate specificity. For comprehensive characterization, researchers should consider combinatorial approaches integrating these methods, as individual techniques may yield incomplete or misleading results about substrate specificity .

How can researchers investigate conformational changes in HI_0663 during the ATP hydrolysis cycle?

Investigating the dynamic conformational changes that occur during the ATP hydrolysis cycle of HI_0663 requires techniques capable of capturing protein movements at different stages of the transport process. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable information about regions of conformational flexibility and solvent accessibility changes upon nucleotide binding, helping map the structural dynamics of different domains during the catalytic cycle. Single-molecule Förster resonance energy transfer (smFRET) offers a powerful approach by strategically placing fluorescent probes at key positions within HI_0663 to monitor distance changes between specific residues during conformational transitions in real-time. For capturing distinct conformational states, researchers can employ ATP-binding deficient mutants or non-hydrolyzable ATP analogs (such as AMP-PNP) to trap HI_0663 in specific states of the transport cycle. Molecular dynamics simulations complement experimental approaches by predicting atomic-level movements over time scales difficult to capture experimentally. The implementation of these techniques requires careful consideration of protein engineering strategies, such as introducing specific labeling sites while preserving protein function, and often necessitates comparative analysis between wild-type HI_0663 and variants with mutations in conserved motifs of the nucleotide binding domains that regulate the conformational changes between open and closed states .

What experimental approaches can determine the physiological role of HI_0663 in H. influenzae?

Determining the physiological role of HI_0663 in H. influenzae requires integrating genetic, biochemical, and physiological approaches. Genetic manipulation techniques, such as transformed recombinant enrichment profiling (TREP), can be particularly powerful for identifying phenotypes associated with HI_0663 . TREP utilizes natural transformation to generate pools of recombinants, followed by phenotypic selection and deep sequencing to identify genetic variations responsible for specific traits . Creation of HI_0663 deletion mutants and complementation strains enables comparative analysis of growth patterns, survival rates, and stress responses under various conditions. Researchers should examine phenotypes relevant to ABC transporter functions, such as nutrient utilization, antibiotic resistance, and virulence in infection models . Transcriptomic and proteomic analyses comparing wild-type and HI_0663 mutant strains can identify genes and proteins with altered expression, providing insights into metabolic pathways affected by HI_0663 disruption. For assessing the role of HI_0663 in pathogenesis, infection models using epithelial cell cultures or animal models can reveal whether this ABC transporter contributes to colonization, invasion, or persistence during infection, similar to studies conducted with other H. influenzae virulence factors .

How is expression of HI_0663 regulated in response to environmental conditions?

Understanding the regulation of HI_0663 expression requires systematic investigation of transcriptional and post-transcriptional control mechanisms under varying environmental conditions. Quantitative PCR (qPCR) and RNA sequencing should be employed to measure HI_0663 transcript levels across different growth phases and in response to diverse environmental stressors including nutrient limitation, oxidative stress, pH changes, and exposure to antimicrobial compounds. Promoter analysis using reporter gene fusions (such as lacZ or luciferase) can identify regulatory elements controlling HI_0663 expression, while chromatin immunoprecipitation (ChIP) experiments can determine transcription factors directly interacting with the HI_0663 promoter region. If HI_0663 functions in nutrient acquisition, its expression might be regulated by substrate availability through mechanisms similar to other bacterial ABC transporters. Post-transcriptional regulation should also be investigated, including potential regulation by small RNAs or RNA-binding proteins that might influence mRNA stability or translation efficiency. Protein-level regulation via post-translational modifications can be assessed using mass spectrometry approaches to identify potential phosphorylation, acetylation, or other modifications that might modulate HI_0663 activity in response to changing cellular conditions or environmental signals .

How does HI_0663 compare structurally and functionally to homologous ABC transporters in other bacterial species?

Comparative analysis of HI_0663 with homologous ABC transporters in other bacterial species provides evolutionary context and functional insights. Researchers should begin with comprehensive sequence alignment of HI_0663 against characterized ABC transporters across diverse bacterial species, focusing particularly on the highly conserved nucleotide binding domains that contain diagnostic sequence motifs (Walker A, Walker B, signature motif, H-loop, and Q-loop) . Phylogenetic analysis can position HI_0663 within the evolutionary framework of ABC transporters, potentially indicating functional relationships based on clustering patterns. Structural comparison should extend beyond sequence to include predicted or determined three-dimensional arrangements, with particular attention to the transmembrane domains which typically determine substrate specificity despite lower sequence conservation . Functional comparison requires careful assessment of substrate specificity, transport kinetics, and regulatory mechanisms across homologous transporters, which may reveal conserved or divergent functional attributes. Researchers should utilize databases such as Pfam and specialized ABC transporter databases to facilitate these comparisons . Additionally, examination of genomic context conservation (synteny analysis) around HI_0663 orthologues can provide insights into functional association with specific metabolic pathways or stress responses that have been conserved or diverged across bacterial species through evolutionary processes.

What can genomic context analysis reveal about the functional associations of HI_0663?

Genomic context analysis represents a powerful approach for generating hypotheses about the functional role of uncharacterized proteins like HI_0663. Researchers should examine the chromosomal neighborhood of HI_0663 in H. influenzae to identify co-localized genes that may form functional units or operons. Genes frequently co-occurring with ABC transporter components often encode substrate-binding proteins, regulatory elements, or enzymes involved in metabolic pathways utilizing transported substrates. Comparative analysis of this genomic organization across multiple H. influenzae strains and related species can distinguish conserved gene clusters that suggest fundamental functional relationships from strain-specific arrangements that might indicate adaptive specialization. Transcriptomic data analysis can complement genomic context by identifying genes co-expressed with HI_0663 under various conditions, potentially revealing functional associations not apparent from genomic proximity alone. Protein-protein interaction studies, including pull-down assays with tagged HI_0663 followed by mass spectrometry identification of interaction partners, can identify physical associations with other cellular components. Integration of these genomic context insights with computational prediction tools specifically designed for ABC transporters, such as the 188D feature extraction method combined with Random Forest classification (which has demonstrated 89% accuracy in predicting ABC transporter function), provides a comprehensive framework for generating testable hypotheses about HI_0663 function .

How can site-directed mutagenesis be used to investigate structure-function relationships in HI_0663?

Site-directed mutagenesis represents a foundational approach for investigating structure-function relationships in HI_0663. Researchers should initially target highly conserved motifs within the nucleotide binding domain (NBD), including the Walker A motif (GXXGXGKS/T), Walker B motif (ϕϕϕϕD, where ϕ is a hydrophobic residue), signature motif (LSGGQ), H-loop, and Q-loop, which collectively coordinate ATP binding and hydrolysis . Systematic mutation of these motifs with substitutions that either abolish function (e.g., lysine to alanine in Walker A) or introduce subtle changes (conservative substitutions) can distinguish residues essential for catalysis from those involved in fine-tuning activity. Beyond the NBD, researchers should target putative substrate-binding residues within the transmembrane domains based on homology modeling or structural predictions. Creating chimeric proteins by swapping domains between HI_0663 and well-characterized ABC transporters can help define regions responsible for substrate specificity. Each mutant should undergo comprehensive functional characterization including ATP binding assays, ATPase activity measurements, substrate transport assessments (if applicable), and structural analysis to determine how specific amino acid changes affect protein conformation and function. Additionally, complementation studies introducing mutant variants into HI_0663-deficient strains can assess the physiological consequences of these mutations in vivo, providing crucial context for interpreting biochemical results .

What reconstitution systems can evaluate HI_0663 transport activity in vitro?

Developing effective reconstitution systems for evaluating HI_0663 transport activity requires careful consideration of membrane environment and measurement methodology. Researchers should first consider proteoliposome-based reconstitution, wherein purified recombinant HI_0663 (preferably obtained through methods similar to those used for other H. influenzae recombinant proteins) is incorporated into artificial lipid vesicles with defined composition. This system allows precise control over lipid composition, which can significantly impact ABC transporter activity and stability. The reconstitution process typically involves detergent-mediated incorporation followed by detergent removal through dialysis or adsorption onto hydrophobic beads. To assess transport activity, researchers must establish differential conditions across the proteoliposome membrane and employ detection methods appropriate for the suspected substrate class. For importers, this often involves preloading vesicles with detection reagents that produce measurable signals upon substrate entry. Alternatively, nanodiscs—disc-shaped lipid bilayers stabilized by membrane scaffold proteins—offer advantages for biophysical studies by providing a more homogeneous environment than liposomes while maintaining native-like bilayer properties. Solid-supported membrane electrophysiology represents another powerful approach, particularly suitable for electrogenic transporters, as it can detect charge movements associated with transport cycles with high temporal resolution. Each reconstitution system requires careful optimization of protein-to-lipid ratios, buffer conditions, and detection methodologies to accurately reflect the native activity of HI_0663 .

How should researchers address contradictory results between in vitro and in vivo studies of HI_0663 function?

Addressing contradictions between in vitro and in vivo studies of HI_0663 function requires systematic evaluation of methodological differences and biological context. Researchers should first critically examine whether the recombinant HI_0663 protein used in vitro retains all post-translational modifications and structural features of the native protein—differences in tags, expression systems, or purification methods can significantly affect protein function . The lipid environment represents another critical variable, as membrane composition in artificial systems rarely replicates the complex bacterial membrane environment precisely. Researchers should consider validating in vitro findings using multiple membrane mimetics with varying compositions to assess whether specific lipids modulate HI_0663 activity. In vivo studies may be complicated by functional redundancy among ABC transporters, potentially masking phenotypes in single-gene knockout studies. To address this, researchers should consider constructing combinatorial mutants targeting multiple transporters with predicted functional overlap. Additionally, the physiological conditions examined in laboratory settings may not fully represent the environmental niches H. influenzae encounters during infection or colonization, particularly regarding nutrient availability, pH, or oxygen tension. Time-resolved studies can also be valuable, as transient phenotypes might be missed in endpoint analyses. Finally, integration of multi-omics approaches (transcriptomics, proteomics, metabolomics) can provide a systems-level perspective on HI_0663 function that helps reconcile contradictory observations by revealing compensatory mechanisms or condition-specific functional roles .

What statistical approaches are most appropriate for analyzing HI_0663 structure-function data?

Selection of appropriate statistical approaches for analyzing HI_0663 structure-function data depends on the specific experimental design and data characteristics. For enzyme kinetic studies examining ATP hydrolysis, nonlinear regression analysis using models such as Michaelis-Menten or Hill equations provides quantitative parameters (Km, Vmax, Hill coefficient) that can be statistically compared across wild-type and mutant variants using extra sum-of-squares F tests. When analyzing large datasets from mutagenesis studies, multivariate statistical methods such as principal component analysis (PCA) or hierarchical clustering can identify patterns in how different mutations affect multiple functional parameters simultaneously. Correlation analyses between structural parameters (e.g., distance measurements from molecular dynamics simulations) and functional readouts can reveal structure-function relationships that might not be apparent from univariate analyses. For in vivo experiments with non-normally distributed data (common in bacterial growth and survival studies), non-parametric tests should be employed. When analyzing high-throughput datasets, such as those generated by deep sequencing in TREP approaches , researchers should implement appropriate corrections for multiple testing (e.g., Benjamini-Hochberg procedure) to control false discovery rates. For all statistical analyses, researchers should report effect sizes alongside p-values to convey biological significance in addition to statistical significance. Power analyses should be conducted a priori to ensure sufficient sample sizes for detecting biologically meaningful effects, particularly important when working with subtle phenotypes often associated with ABC transporter mutations .

How might HI_0663 contribute to H. influenzae pathogenesis and host-pathogen interactions?

The potential contribution of HI_0663 to H. influenzae pathogenesis warrants thorough investigation given the established roles of ABC transporters in bacterial virulence. As an ABC transporter ATP-binding protein, HI_0663 may participate in nutrient acquisition during infection, particularly in nutrient-limited host environments like the respiratory tract where H. influenzae typically resides . Researchers should consider whether HI_0663 contributes to metal ion acquisition (such as iron, zinc, or manganese), which is often critical for pathogen survival in hosts where nutritional immunity restricts microbial access to essential metals. Alternatively, HI_0663 might function in antimicrobial peptide resistance by mediating their export, similar to other bacterial ABC transporters that contribute to innate immunity evasion. Investigation of HI_0663's potential role in biofilm formation—a critical aspect of H. influenzae persistence during chronic infections—should be prioritized, as other ABC transporters have been implicated in exporting extracellular matrix components. Researchers can employ techniques similar to those used for studying HMW1 (High Molecular Weight adhesin 1), which has been identified as crucial for H. influenzae intracellular invasion . Comparison of wild-type and HI_0663-deficient strains in cellular infection models and animal models of respiratory infection would provide direct evidence of its contribution to colonization, invasion, or persistence. Transcriptomic analysis of H. influenzae during infection can determine whether HI_0663 expression is upregulated in vivo, suggesting functional importance during pathogenesis .

What methodologies can assess the potential of HI_0663 as a therapeutic target?

Evaluating HI_0663 as a potential therapeutic target requires comprehensive assessment of its essentiality, accessibility, and druggability. Researchers should first determine whether HI_0663 is essential for H. influenzae survival or virulence through conditional knockdown systems or transposon mutagenesis approaches that can distinguish genes essential for viability from those contributing to fitness. High-throughput screening assays using ATPase activity of purified recombinant HI_0663 can identify small molecule inhibitors from chemical libraries. Structure-based drug design approaches, informed by crystallographic or computational structural models of HI_0663, can guide rational development of inhibitors targeting critical functional sites. Researchers should test candidate inhibitors against a panel of HI_0663 orthologues from multiple pathogenic species to assess potential broad-spectrum applications, while counter-screening against human ABC transporters to evaluate selectivity. Cell-based assays measuring growth inhibition, biofilm formation, or intracellular invasion in the presence of inhibitors can validate target engagement in a cellular context. For promising candidates, pharmacokinetic and pharmacodynamic studies in animal infection models are essential to assess in vivo efficacy. Resistance development studies, involving serial passage of H. influenzae in sub-inhibitory concentrations of compounds, can predict potential resistance mechanisms and inform inhibitor optimization. Finally, combination studies with established antibiotics can determine whether HI_0663 inhibitors might enhance efficacy of existing therapies, potentially addressing resistance challenges in H. influenzae infections .

What emerging technologies could advance understanding of HI_0663 function and regulation?

Emerging technologies across multiple disciplines offer promising approaches for deepening our understanding of HI_0663 function and regulation. CryoEM advances, particularly in single-particle analysis, now enable structural determination of membrane proteins like ABC transporters without crystallization, potentially revealing HI_0663 in multiple conformational states during its transport cycle. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems adapted for bacterial use provide precise tools for modulating HI_0663 expression, enabling temporal control for studying gene essentiality and physiological impact. Time-resolved mass spectrometry techniques can capture transient protein-protein interactions and conformational changes occurring during the ATP hydrolysis cycle with unprecedented detail. For in vivo studies, advanced imaging technologies such as super-resolution microscopy and correlative light and electron microscopy can determine the subcellular localization and dynamic behavior of HI_0663 within bacterial cells. Single-cell RNA sequencing applied to bacterial populations could reveal heterogeneity in HI_0663 expression and function across individual cells within a population. Microfluidic devices coupled with live-cell imaging offer powerful platforms for studying HI_0663 function under precisely controlled and rapidly changing environmental conditions. Synthetic biology approaches, including minimal genome systems and orthogonal expression platforms, provide opportunities to study HI_0663 function in simplified genetic backgrounds that minimize confounding factors from redundant transporters or complex regulatory networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.