Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_1051 (HI_1051)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be selected during production. If you have a preferred tag type, please inform us, and we will prioritize development according to your specification.
Synonyms
HI_1051; Uncharacterized ABC transporter ATP-binding protein HI_1051
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1051
Target Protein Sequence
MFNKIFSWFENRLNPYPESNPTTPKKGLFRFIWSSITGMKGWIFLLAILTVGTGVMEAVL FQFMGTLVDWLGTFTPERLWQEKSHLLIGMAALLLISIVWGFLASAVHLQTLQGVFPMRL RWNFHRLMLGQSLSFYQDEFAGRVSAKVMQTALAVRDTVLTLANMFVYVLVYFITSGVVL VALDSWFLLPFITWIILFGLILRTLIPKLSKTAQRQADARSLMTGRITDAYSNIATVKLF SHGSREATYAKRSMQDFMVTVHAQMRLATSLDTLTYATNILLTLSTAILGIILWKNGQVG VGAIATATAMALRVNGLSRWIMWESARLFENIGTVNDGMNTLTKPHTIVDKPQASPLQVK QGEIKFNDITFAYDPTKPLLNHFNLTIKPGEKVGLIGRSGAGKSTIVNLLLRFYEAQQGE ITIDGQNVLNVQQESLRRQIGLVTQDTSLLHRSVRDNIIYGRPNATDEEMVLAAERAEAA DFIPFLSDSQGRKGYDAHVGERGVKLSGGQRQRIAIARVMLKDAPILLLDEATSALDSEV EVAIQESLDKMMENKTVIAIAHRLSTIAAMDRLIVLDKGQIVEQGTHAELLELNGLYAKL WNHQSGGFLSESAE
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1051

STRING: 71421.HI1051

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted domain architecture of the HI_1051 ABC transporter protein?

HI_1051 follows the canonical domain architecture of ABC transporter ATP-binding proteins, consisting of a nucleotide-binding domain (NBD) with highly conserved Walker A and Walker B motifs for ATP binding and hydrolysis. The protein contains the characteristic ABC signature motif (LSGGQ) positioned between these Walker motifs. Unlike complete ABC transporters, HI_1051 lacks transmembrane domains (TMDs) and likely functions as part of a multiprotein complex. Structural predictions suggest similarity to other bacterial ABC transporter ATP-binding proteins, with distinct NBD dimerization interfaces that become engaged during the ATP catalytic cycle .

How does the ATP hydrolysis mechanism in HI_1051 compare to other characterized ABC transporters?

The ATP hydrolysis mechanism in HI_1051 likely follows the same fundamental principles observed in well-characterized ABC transporters like PCAT1. ATP binding promotes NBD dimerization, creating a "sandwich" formation where two ATP molecules are positioned at the dimer interface. Each ATP molecule interacts with the Walker A and B motifs from one NBD and the signature motif from the opposite NBD. Hydrolysis triggers conformational changes that propagate to associated transmembrane domains.

Research indicates that in most ABC transporters, including the likely mechanism for HI_1051, the ATP-bound, NBD-dimerized conformation represents the lowest energy state. The rate-limiting step in the transport cycle varies between transporters – for some like PCAT1, NBD dimerization is rate-limiting, while for others, different steps may constitute the kinetic bottleneck .

What expression systems are most effective for recombinant production of HI_1051?

Based on successful approaches with similar ABC transporters from pathogenic bacteria, Escherichia coli strain BL21(DE3) with codon optimization (such as the RIL plasmid) has proven effective for HI_1051 expression. The protein can be expressed with an N-terminal tag (GST or His6) to facilitate purification. Expression conditions typically include induction with IPTG (0.5-1.0 mM) at lower temperatures (16-25°C) for 4-16 hours to promote proper folding .

Yields can be optimized by considering the following experimental parameters:

Expression ParameterRecommended ConditionsNotes
E. coli strainBL21(DE3) RILCompensates for rare codons
Induction temperature18°CReduces inclusion body formation
IPTG concentration0.5 mMHigher concentrations may not improve yield
Expression time16 hoursExtended time improves yield without degradation
MediaTerrific BrothEnhanced biomass production

How can Transformed Recombinant Enrichment Profiling (TREP) be applied to study HI_1051 function in Haemophilus influenzae?

TREP represents a powerful approach for investigating HI_1051 function through natural transformation and phenotypic selection. This methodology allows researchers to:

  • Generate complex pools of recombinants using donor DNA from strains with known phenotypic variations

  • Apply selective pressure relevant to HI_1051 function (e.g., antibiotic resistance if the protein contributes to efflux)

  • Use deep sequencing to identify genetic variations associated with the selected phenotype

The experimental design would mirror the approach described for investigating intracellular invasion phenotypes. First, donor genomic DNA from a strain with the phenotype of interest would be used to transform naturally competent cells lacking that phenotype. Following selection, genomic DNA from enriched pools would be sequenced to high coverage, and donor-specific allele frequencies would be calculated at diagnostic SNPs .

TREP offers significant advantages over traditional genetic approaches as it can simultaneously map multiple genetic determinants contributing to complex phenotypes, making it particularly valuable for studying multifactorial processes potentially influenced by HI_1051 .

What structural approaches yield the most informative data about HI_1051 conformational states?

Cryo-electron microscopy (cryo-EM) has emerged as the premier approach for elucidating the conformational dynamics of ABC transporters like HI_1051. Unlike X-ray crystallography, which typically captures a single state, cryo-EM can resolve multiple conformations from the same sample, providing crucial insights into the protein's functional cycle.

For HI_1051, cryo-EM studies should be designed to capture both equilibrium and non-equilibrium conditions:

  • Equilibrium conditions: Sample preparation with ATP but without Mg²⁺ prevents ATP hydrolysis, allowing observation of the thermodynamically favored states

  • Non-equilibrium conditions: Addition of Mg²⁺ to enable ATP hydrolysis reveals the kinetically determined distribution of states during active transport

This approach has revealed fundamental insights about ABC transporters, demonstrating that the NBD-dimerized conformation typically represents the lowest energy state, while conformational distributions under ATP turnover conditions reflect rate-limiting steps in the transport cycle .

Data collection should aim for 200,000+ particles with processing focused on identifying distinct conformational classes through 3D classification. Resolution targets of 3.5Å or better will enable visualization of nucleotide binding and key conformational changes during the transport cycle .

How does HI_1051 interact with other components in potential transport complexes?

As an ATP-binding protein without transmembrane domains, HI_1051 must interact with partner proteins to form functional transport complexes. Research approaches to characterize these interactions include:

  • Affinity purification coupled with mass spectrometry (AP-MS) to identify binding partners

  • Bacterial two-hybrid assays to confirm direct interactions

  • Co-expression and co-purification studies to isolate stable complexes

  • In vivo crosslinking to capture transient interactions

The resulting data should be analyzed for proteins that consistently co-purify with HI_1051 under varying conditions. Known Haemophilus influenzae membrane proteins should be scrutinized as potential partners, especially those genetically linked to HI_1051 or co-regulated under relevant conditions.

Functional reconstitution of purified complexes in liposomes can confirm transport activity and substrate specificity, while site-directed mutagenesis of predicted interface residues can validate the importance of specific interactions .

What purification strategy yields the highest activity for recombinant HI_1051?

A multi-step purification approach yields the highest activity for recombinant HI_1051, with careful attention to buffer conditions that maintain native conformation and activity:

  • Affinity chromatography (GST or Ni-NTA) as the initial capture step

  • Tag removal using a site-specific protease (e.g., TEV or PreScission)

  • Ion exchange chromatography to separate cleaved protein from contaminants

  • Size exclusion chromatography as a final polishing step

Critical buffer components include:

ComponentRecommended ConcentrationPurpose
HEPES or Tris20-50 mM, pH 7.5-8.0Maintains physiological pH
NaCl150-300 mMPrevents nonspecific interactions
Glycerol5-10%Enhances protein stability
DTT or TCEP1-5 mMMaintains reduced cysteines
MgCl₂5 mMRequired for ATP binding/hydrolysis
ATP or analog0-1 mMStabilizes active conformation

The purification should be performed at 4°C with protease inhibitors present in the initial lysis buffer. ATP hydrolysis assays using a malachite green phosphate detection system should be conducted at each purification stage to monitor specific activity and recovery .

How can researchers effectively measure the ATPase activity of purified HI_1051?

Accurate measurement of HI_1051 ATPase activity requires careful experimental design and appropriate controls. The recommended approach combines multiple complementary methods:

  • Colorimetric phosphate release assays (malachite green or molybdate-based) for high-throughput kinetic analysis

  • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) for real-time monitoring

  • Radiolabeled ATP hydrolysis assays for highest sensitivity

Standard reaction conditions should include:

  • 20-50 mM Tris or HEPES buffer (pH 7.5)

  • 100-150 mM NaCl

  • 5-10 mM MgCl₂

  • 0-5 mM ATP (for Km determination)

  • 1-5 μg purified HI_1051

  • 37°C incubation (physiological temperature for H. influenzae)

Controls must include:

  • No-enzyme controls

  • Heat-inactivated enzyme controls

  • Walker A/B mutants (K45A, D173N) with impaired ATP binding/hydrolysis

Data analysis should incorporate Michaelis-Menten kinetics to determine Km and Vmax parameters, with non-linear regression for accurate fitting. Thermodynamic parameters can be determined by performing assays across a temperature range (15-45°C) and constructing Arrhenius plots .

What approaches can identify potential substrates of transport complexes containing HI_1051?

Identifying substrates transported by complexes containing HI_1051 requires a multifaceted strategy:

  • Bioinformatic analysis comparing HI_1051 to characterized ABC transporters with known substrates

  • Gene neighborhood analysis to identify co-localized genes potentially involved in substrate metabolism

  • Transcriptomic studies to identify co-regulated genes under various growth conditions

  • In vivo transport assays using radiolabeled or fluorescently labeled candidate substrates

  • In vitro reconstitution of purified complexes in proteoliposomes for direct transport measurements

Researchers should prioritize candidate substrates based on H. influenzae physiology and pathogenesis, including:

  • Essential metabolites absent in host environments

  • Antimicrobial compounds encountered during infection

  • Host-derived molecules that may serve as nutrients or signaling molecules

Transport activity can be assessed using membrane vesicles from H. influenzae expressing native or recombinant HI_1051, with transport measured as accumulation of labeled substrates inside vesicles. Competitive inhibition assays with unlabeled compounds can help define substrate specificity profiles .

How can researchers distinguish between different conformational states of HI_1051 in cryo-EM studies?

Distinguishing between conformational states of HI_1051 in cryo-EM studies requires sophisticated data processing and analysis approaches:

  • 3D Classification: Perform unsupervised 3D classification without imposing symmetry to identify distinct conformational states.

  • Focused Classification: Apply masks around regions of interest (particularly the NBDs) to enhance classification sensitivity.

  • Multibody Refinement: Treat different domains as separate rigid bodies to detect subtle conformational differences.

  • Transition Analysis: Measure key distances between structural elements that define conformational states:

    • Distance between Walker A motif (G522 equivalent) and signature motif (S624 equivalent) of opposing NBDs

    • Degree of NBD dimerization

    • Pore openings at the predicted substrate binding site

  • Nucleotide Density Analysis: Examine density features corresponding to bound nucleotides (ATP, ADP) and metal ions (Mg²⁺).

Under equilibrium conditions (ATP without Mg²⁺), expect enrichment of the NBD-dimerized, outward-facing conformation. Under ATP turnover conditions (ATP with Mg²⁺), anticipate a shift toward NBD-separated, inward-facing conformations, with only a small fraction in the NBD-dimerized state .

What are the most critical regions to target for site-directed mutagenesis studies of HI_1051?

Strategic site-directed mutagenesis of HI_1051 should target conserved motifs and regions critical for ABC transporter function:

  • ATP Binding/Hydrolysis Sites:

    • Walker A motif: Substitute the invariant lysine (K→A) to disrupt ATP binding

    • Walker B motif: Modify the catalytic aspartate (D→N) to permit ATP binding but prevent hydrolysis

    • Q-loop: Alter the glutamine involved in coordinating the attacking water molecule

    • H-loop: Mutate the histidine that positions the γ-phosphate for hydrolysis

  • Dimerization Interface:

    • ABC signature motif (LSGGQ): Modify residues that contact ATP from the opposing NBD

    • D-loop: Alter residues involved in NBD-NBD communication during the ATP cycle

  • Potential Substrate-Interacting Regions:

    • Examine sequence alignments with characterized ABC transporters to identify potential substrate-binding residues

    • Target residues in unique insertions or extensions specific to HI_1051

MotifConsensus SequenceKey Residue to MutateExpected Effect
Walker AGxxGxGKSTLysine (K)Abolishes ATP binding
Walker BhhhhDEGlutamate (E)Permits ATP binding but prevents hydrolysis
SignatureLSGGQSerine (S)Disrupts NBD dimerization
Q-loopQGlutamine (Q)Impairs coordination of catalytic water
H-loopHHistidine (H)Reduces ATP hydrolysis efficiency

Each mutant should be characterized for expression, folding, ATP binding (using fluorescent ATP analogs), and ATP hydrolysis. Transport assays with reconstituted complexes can then correlate biochemical defects with functional outcomes .

How can researchers integrate structural and functional data to develop a comprehensive model of HI_1051's role in transport mechanisms?

Developing a comprehensive model of HI_1051's transport mechanism requires integrating multiple data types:

  • Structural Integration:

    • Map conformational states observed in cryo-EM to specific steps in the transport cycle

    • Identify structural changes that occur during ATP binding, hydrolysis, and release

    • Determine how conformational changes in HI_1051 could be transmitted to transmembrane domains

  • Functional Correlation:

    • Establish relationships between ATP hydrolysis rates and transport efficiency

    • Determine how mutations that affect specific structural elements impact function

    • Identify conditions that alter the rate-limiting step in the transport cycle

  • Computational Approaches:

    • Molecular dynamics simulations to model transitions between observed states

    • Normal mode analysis to identify collective motions relevant to function

    • Molecular docking to predict interactions with potential transport substrates

  • Integration with H. influenzae Biology:

    • Correlate HI_1051 function with bacterial fitness in various environments

    • Establish the role of HI_1051-containing complexes in pathogenesis

    • Identify potential inhibitors that could serve as antimicrobial agents

A comprehensive model should address:

  • Energy coupling between ATP hydrolysis and substrate translocation

  • Conformational transmission from NBDs to TMDs

  • Substrate specificity determinants

  • Regulatory mechanisms controlling transport activity

This integrated approach provides a framework for understanding how HI_1051 contributes to essential transport processes in H. influenzae and potentially identifies new therapeutic targets .

How might TREP approaches be combined with structural studies to advance understanding of HI_1051 function?

Integrating TREP approaches with structural studies offers a powerful strategy for comprehensively understanding HI_1051 function:

  • Structure-Guided TREP: Use structural information about HI_1051 to design targeted transformations focusing on regions predicted to be functionally important.

  • TREP-Informed Structural Studies: Identify natural variations in HI_1051 through TREP that affect function, then perform structural studies on these variants to understand the molecular basis of functional differences.

  • Chimeric Approaches: Generate chimeric HI_1051 proteins by transforming specific structural elements from functionally distinct H. influenzae strains, then determine their structures and functions.

  • Epistasis Analysis: Use TREP to identify genetic interactions between HI_1051 and other genes, then conduct structural studies on protein complexes implicated by these genetic relationships.

This combined approach can reveal how natural genetic variation impacts structure-function relationships in HI_1051 and how these variations contribute to H. influenzae pathogenesis or environmental adaptation .

What methodological triangulation approaches would most enhance the reliability of research findings on HI_1051?

Methodological triangulation—combining multiple research approaches—significantly enhances the reliability and depth of HI_1051 research findings:

  • Combined Structural Methodologies:

    • Integrate cryo-EM, X-ray crystallography, and NMR to overcome limitations of individual methods

    • Use cryo-EM for conformational flexibility, crystallography for atomic details of stable states, and NMR for dynamic regions

    • SAXS/SANS to validate solution structures under physiological conditions

  • Functional-Structural Integration:

    • Correlate binding and hydrolysis measurements with structural observations

    • Use EPR spectroscopy to monitor conformational changes during the ATP cycle

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • In Vitro-In Vivo Connections:

    • Compare biochemical findings with bacterial phenotypes using isogenic mutants

    • Validate in vitro transport findings with in vivo accumulation studies

    • Use structure-guided mutations to test functional hypotheses in living bacteria

  • Comparative Approaches:

    • Study HI_1051 homologs from different Haemophilus species

    • Compare findings with well-characterized ABC transporters from model organisms

    • Examine variation across clinical isolates with different virulence properties

How can researchers apply the thermodynamic and kinetic insights from recent ABC transporter studies to HI_1051 research?

Recent advances in understanding ABC transporter energetics provide a framework for HI_1051 research:

  • Equilibrium vs. Non-equilibrium Analysis:

    • Design experiments to distinguish between thermodynamic preferences (studied under equilibrium) and kinetic bottlenecks (revealed under turnover conditions)

    • Compare conformational distributions in the presence of ATP with and without Mg²⁺

    • Identify the lowest energy state and rate-limiting step in the HI_1051 transport cycle

  • Temperature-Dependent Studies:

    • Perform functional and structural studies across temperature ranges

    • Calculate activation energies for different steps in the transport cycle

    • Identify temperature-sensitive conformational transitions

  • Pressure-Based Approaches:

    • Use high-pressure techniques to analyze volume changes during the transport cycle

    • Identify rate-limiting conformational changes based on activation volumes

    • Distinguish between entropy-driven and enthalpy-driven processes

  • Single-molecule Techniques:

    • Apply FRET to monitor conformational dynamics in real-time

    • Use optical tweezers to measure forces generated during transport

    • Correlate single-molecule observations with ensemble measurements

By applying these approaches, researchers can determine whether NBD dimerization is rate-limiting for HI_1051 (as observed for PCAT1) or if other steps constitute the kinetic bottleneck. This information is crucial for understanding the energy transduction mechanism and identifying potential points for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.