Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_1467 (HI_1467)

Shipped with Ice Packs
In Stock

Description

ABC Transporter Context

ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). HI_1467 is predicted to function as the ATP-binding subunit (NBD) of an uncharacterized ABC transporter . While its exact substrate remains unknown, homologous systems in H. influenzae (e.g., HI1470/71) transport metal ions like molybdate or tungstate via a periplasmic binding protein (PBP)-dependent mechanism .

Functional Context and Homologs

  • Binding Specificity: HI_1467’s homolog HI1472 (MolA) binds molybdate/tungstate with ~100 μM affinity, classifying it as a low-affinity transporter .

  • Operon Organization: In H. influenzae, ABC transporter genes (e.g., molABC) are often clustered, suggesting coordinated regulation .

  • Role in Pathogenesis: ABC transporters in H. influenzae are implicated in nutrient acquisition and virulence, making them potential antibacterial targets .

Research Applications

  • Mechanistic Studies: HI_1467 serves as a model for probing ATP hydrolysis-coupled transport in uncharacterized ABC systems .

  • Antimicrobial Development: ABC transporters are explored as vaccine or drug targets due to their surface exposure and conservation .

  • Biochemical Assays: SDS-PAGE analysis confirms purity (>90%), enabling functional studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
HI_1467; Uncharacterized ABC transporter ATP-binding protein HI_1467
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1467
Target Protein Sequence
MNWQTELNNSLNWILTALFWVVLCFSVTMLALKQTTFGKKFWCIVSPSMDKKTSIKLILM LLVLFIMILLEVRFSVLNSFFYNGLYSSMQELNIEKFWFFAKLNALLVVAQVIHAIADYF FQQVFEIRWLESFNATLVKRWLNKKKYYRLKYERDLPDNIDQRIEQDAREFITSTVQIVR GVINSVLTTIEFTIILWSLSGVLTLFGFNIEKGVVFFIYAFIIFATLMSVWIGRPLIKLN FTKEKLNGDYRYSLIRVRDNAESIAFYNGEPKEQTFLQHQFRQIIHNRWSIVLKMLGLNS FNSGVTRVAKLLPLMLQAPRFFSGQIKLGDMHQTVQAFNRLMTALSFFRLFYEQFTLYQA RLNRLYGFITKMDELDKQNVHHPFHCSHRVALKNFGIKDEQGHVLLNNLNINLENGDALL IQGASGTGKTSLLKAIAGIYPFETIGIAEHPCMGSLFLPQRPYMPQGTLREAICYPNINP SHAELEQTMKDCALGKYIHALNVKNDWQAILSPGELQRVAFIRILLTKPDVVFLDETTSA LDETTENLLYQTIKERLPEMIILSVGHRSTLQQFHNKQLKLDVCLLCEN
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1467

STRING: 71421.HI1467

Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_1467?

HI_1467 is an ATP-binding protein component of an ABC transporter system in Haemophilus influenzae. As a member of the ABC transporter family, HI_1467 likely contains nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to power the transport of specific substrates across the cell membrane. The "uncharacterized" designation indicates that the specific substrates, transport mechanism, and physiological role of this particular transporter have not been fully elucidated through experimental studies. ABC transporters typically consist of two transmembrane domains (TMDs) that form the substrate pathway across the membrane and two NBDs that power the transport through ATP hydrolysis. HI_1467 represents one of the NBD components of a complete ABC transporter complex.

H. influenzae is a common inhabitant of the upper respiratory tract and can cause serious infections of mucosal surfaces . Understanding the function of its transport systems, including HI_1467, may provide crucial insights into bacterial physiology, virulence mechanisms, and potential therapeutic targets.

How does studying HI_1467 contribute to our understanding of H. influenzae pathogenesis?

Studying HI_1467 offers several important contributions to understanding H. influenzae pathogenesis:

First, H. influenzae penetrates respiratory epithelium during carriage and invasive disease , and ABC transporters may facilitate essential nutrient acquisition during this process. The bacterium must adapt to different microenvironments within the host, and transport systems are critical for this adaptation.

Second, many ABC transporters in bacterial pathogens contribute to virulence through roles in nutrient acquisition, toxin export, or antimicrobial resistance . Characterizing HI_1467 may reveal similar contributions to H. influenzae pathogenicity.

Third, nontypeable H. influenzae isolates can adhere efficiently to epithelial cells through various adhesins , and transport proteins may support these interactions by maintaining cellular homeostasis during attachment and invasion.

Fourth, understanding the specific substrates transported by the HI_1467-containing complex could identify metabolic dependencies that might be exploited for therapeutic intervention.

Finally, as an uncharacterized protein, HI_1467 represents a knowledge gap in the functional annotation of the H. influenzae genome. Filling this gap contributes to a more complete understanding of this pathogen's biology.

How should I design a hypothesis-testing experiment to characterize HI_1467 function?

Designing a rigorous hypothesis-testing experiment for HI_1467 characterization requires careful planning following established experimental design principles:

Begin by defining clear hypotheses. For example:

  • Null hypothesis (H₀): "HI_1467 does not function in metal ion transport"

  • Alternative hypothesis (H₁): "HI_1467 functions in metal ion transport"

Identify your key variables, including:

  • Independent variables: protein concentration, ATP concentration, potential substrate types

  • Primary outcome measure: ATP hydrolysis rate, substrate transport rate, or binding affinity

Determine a biologically relevant effect size. Consider what magnitude of effect would indicate functional significance, such as a specific fold-change in ATPase activity or a transport rate comparable to characterized transporters .

Design appropriate controls:

  • Positive controls: Well-characterized ABC transporters with known function

  • Negative controls: Inactive HI_1467 mutants (e.g., Walker A motif mutations)

  • System controls: Non-substrate molecules to demonstrate specificity

Develop a comprehensive data analysis plan:

  • Select appropriate statistical methods for your experimental design

  • Conduct power analysis to determine adequate sample size and replication

  • Establish criteria for handling potential outliers

When executing the experiment, utilize functional assays that directly measure activity:

  • ATPase activity assays to measure ATP hydrolysis rates

  • Transport assays using reconstituted proteoliposomes

  • Substrate binding assays using biophysical methods

This systematic approach ensures that your experimental results will provide meaningful insights into HI_1467 function while minimizing experimental bias and increasing reproducibility .

What are the recommended methods for cloning and expressing recombinant HI_1467?

For successful cloning and expression of recombinant HI_1467, consider the following methodological approach:

Gene Amplification and Cloning:

  • Design primers that include appropriate restriction sites for directional cloning.

  • PCR-amplify the HI_1467 gene from H. influenzae genomic DNA using high-fidelity DNA polymerase.

  • Consider codon optimization if expressing in a heterologous host with different codon usage patterns.

Expression Vector Selection:

  • For high-yield protein production, select vectors with T7-inducible promoter systems, which have proven effective for H. influenzae proteins .

  • Include appropriate fusion tags (His6, GST, or MBP) to facilitate purification and potentially enhance solubility.

  • For membrane-associated proteins like ABC transporters, vectors that provide moderate expression levels often yield better results than those providing very high expression.

Signal Sequence Modification:
Since HI_1467 is likely membrane-associated, consider replacing any native signal sequences with ones optimized for your expression system. For H. influenzae proteins, replacing N-terminal lipid modification signals with secretion signals has been successful in enhancing purification yields .

Expression Host and Conditions:

  • E. coli BL21(DE3) or its derivatives are standard choices for initial expression trials.

  • Test expression at lower temperatures (16-20°C) to allow proper folding of this complex protein.

  • Optimize induction conditions by testing various IPTG concentrations (0.1-1.0 mM) and induction times (4-18 hours).

  • For challenging membrane proteins, specialized E. coli strains like C41(DE3), C43(DE3), or Lemo21(DE3) often provide better results.

Solubility Enhancement Strategies:

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J) to assist in proper folding.

  • Include stabilizing additives in growth media and lysis buffers (glycerol, ATP, Mg²⁺).

  • For membrane proteins, ensure appropriate detergent selection for solubilization.

These methodological considerations should be tailored based on preliminary results and the specific research goals for HI_1467 characterization.

What purification strategies are most effective for HI_1467, and how can I assess protein quality?

Purifying ABC transporter components like HI_1467 presents unique challenges requiring specialized approaches:

Initial Extraction Strategy:

  • If HI_1467 associates with membranes, use gentle detergents (DDM, LMNG, or OG) for solubilization.

  • Include ATP (1-2 mM) and magnesium (5 mM) in all buffers to stabilize the nucleotide-binding domain.

  • Consider using the approach demonstrated for other H. influenzae proteins: replacing the N-terminal lipid modification signal sequence with a secretion signal to avoid complications from lipid modifications .

Multi-Step Purification Protocol:

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Include low concentrations of detergent in buffers if the protein has membrane associations

    • Use gradient elution to separate differentially bound species

  • Ion Exchange Chromatography:

    • Select appropriate resin based on the theoretical isoelectric point of HI_1467

    • This step effectively removes contaminating nucleic acids and similarly-sized proteins

  • Size Exclusion Chromatography:

    • Final polishing step to ensure homogeneity

    • Provides information about the oligomeric state

    • Allows buffer exchange into final storage buffer

Quality Assessment Methods:

  • Purity Analysis:

    • SDS-PAGE with Coomassie staining (expect >95% purity)

    • Western blotting to confirm identity

    • Mass spectrometry for definitive identification and to detect post-translational modifications

  • Functional Assessment:

    • ATPase activity assays to confirm the protein retains its enzymatic function

    • Circular dichroism to verify proper secondary structure content

    • Thermal shift assays to assess protein stability

  • Homogeneity Verification:

    • Dynamic light scattering to detect aggregation

    • Analytical size exclusion chromatography

    • Analytical ultracentrifugation for detailed oligomeric state analysis

Storage Considerations:

  • Determine optimal buffer composition through thermal stability screening

  • Typical storage buffer includes: 20-50 mM Tris or HEPES pH 7.5, 100-150 mM NaCl, 10% glycerol, 1 mM DTT

  • Flash-freeze aliquots in liquid nitrogen and store at -80°C

Systematic optimization of each purification step and thorough quality assessment ensure that subsequent functional and structural studies will yield reliable results.

What methods are most effective for identifying the substrate specificity of HI_1467?

Identifying the substrate specificity of an uncharacterized ABC transporter like HI_1467 requires a multi-faceted approach combining bioinformatic prediction with experimental validation:

Bioinformatic Approaches:

  • Sequence-based classification to place HI_1467 within known ABC transporter subfamilies

  • Homology comparison with functionally characterized ABC transporters

  • Genomic context analysis examining neighboring genes that often relate to substrate processing or metabolism

  • Protein domain architecture analysis focusing on substrate-binding domains

Biochemical Screening Methods:

  • ATPase Activity Stimulation Assay:

    • Measure basal ATPase activity of purified HI_1467

    • Screen compound libraries for substances that stimulate activity

    • Stimulation of ATP hydrolysis often indicates transporter-substrate interaction

  • Transport Assays:

    • Reconstitute the complete transporter (including HI_1467 and partner proteins) into proteoliposomes

    • Use fluorescent or radiolabeled candidate substrates to monitor transport

    • Develop a system to measure substrate accumulation or depletion

  • Direct Binding Studies:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Fluorescence-based binding assays using intrinsic tryptophan fluorescence or extrinsic probes

Genetic and Cellular Approaches:

  • Generate HI_1467 knockout strains and assess phenotypic changes in different media

  • Perform comparative growth studies with wild-type and knockout strains in various nutrient conditions

  • Use transcriptional reporter fusions to identify conditions that upregulate HI_1467 expression

  • Complementation studies with wild-type and mutant variants

Validation Strategies:

  • Demonstrate substrate specificity using competition assays

  • Confirm transport using multiple methodologies

  • Establish structure-function relationships through mutagenesis of predicted substrate-interacting residues

  • Correlate in vitro findings with physiological relevance through in vivo studies

The combination of these approaches provides multiple lines of evidence for substrate specificity, increasing confidence in the functional assignment of this uncharacterized protein.

How can I investigate the coupling mechanism between ATP hydrolysis and substrate transport in HI_1467?

Investigating the coupling mechanism between ATP hydrolysis and substrate transport requires sophisticated approaches that probe the molecular events occurring during the transport cycle:

Kinetic Coupling Analysis:

  • Compare ATP hydrolysis rates in the presence and absence of transport substrate

  • Determine if substrate binding affects nucleotide binding affinity

  • Measure the stoichiometry of ATP hydrolysis per substrate molecule transported

  • Use ATP analogs (non-hydrolyzable, slowly hydrolyzable) to trap intermediate states

Structure-Function Studies:

  • Generate mutations in key motifs:

    • Walker A and B motifs that directly interact with ATP

    • Signature motif (C-loop) involved in ATP hydrolysis

    • Q-loop and D-loop that communicate between NBD and TMD

  • Assess how these mutations affect both ATP hydrolysis and substrate transport

  • Create mutants that can bind but not hydrolyze ATP to isolate specific steps

Conformational Change Monitoring:

  • Use site-directed spin labeling with EPR spectroscopy to measure distances between specific residues during the transport cycle

  • Apply FRET (Förster Resonance Energy Transfer) to monitor domain movements

  • Employ hydrogen-deuterium exchange mass spectrometry to identify regions that undergo conformational changes

  • Utilize conformation-specific antibodies to trap specific states

Thermodynamic Analysis:

  • Determine the energetics of nucleotide binding using ITC

  • Measure activation energies for ATP hydrolysis in different conditions

  • Quantify the thermodynamic coupling between ATP binding/hydrolysis and substrate binding/transport

Intermediate State Characterization:

  • Use vanadate to trap the transition state of ATP hydrolysis

  • Employ rapid kinetic methods (stopped-flow, quenched-flow) to identify transient intermediates

  • Apply time-resolved structural methods (time-resolved FRET, TR-SAXS) to capture structural changes

Computational Approaches:

  • Perform molecular dynamics simulations to model conformational changes

  • Use targeted molecular dynamics to investigate the pathway between different states

  • Apply QM/MM methods to study the chemical details of ATP hydrolysis

By integrating these approaches, researchers can develop a comprehensive model of how HI_1467 couples the energy from ATP hydrolysis to the mechanical work of substrate transport across the membrane.

What role might HI_1467 play in H. influenzae virulence and interaction with host epithelial cells?

Given that H. influenzae penetrates respiratory epithelium during carriage and invasive disease , HI_1467 could potentially contribute to this pathogenic process in several ways:

Nutrient Acquisition During Infection:

Epithelial Cell Interactions:

  • Since H. influenzae adheres to and penetrates epithelial cells , investigate whether HI_1467 affects:

    • Bacterial adhesion to respiratory epithelial cells

    • Invasion into epithelial cells

    • Transcytosis across polarized epithelial layers

  • Use fluorescently labeled bacteria to quantify these processes precisely

Host Defense Evasion:

  • Determine if HI_1467 contributes to resistance against:

    • Antimicrobial peptides (common in respiratory mucosa)

    • Oxidative stress (generated during inflammatory response)

    • Nutrient limitation (host nutritional immunity)

  • Compare survival of wild-type and knockout strains under these stress conditions

Expression Analysis During Infection:

  • Analyze HI_1467 expression levels during:

    • Early colonization of epithelial surfaces

    • Invasion into deeper tissues

    • Biofilm formation

  • Use qRT-PCR, RNA-seq, or reporter constructs to monitor expression

  • Determine if contact with epithelial cells triggers changes in expression

In Vivo Significance:

  • Utilize relevant infection models to compare virulence between wild-type and knockout strains

  • Assess bacterial loads in different tissues

  • Measure host inflammatory responses

  • Evaluate disease progression and outcome

Interaction with Host Cellular Processes:

  • Investigate if substrates transported by HI_1467 affect host cell signaling or metabolism

  • Determine if transport activity alters the microenvironment at the host-pathogen interface

  • Assess potential interactions with host defense mechanisms

Understanding HI_1467's role in virulence could provide insights into H. influenzae pathogenesis and potentially identify new therapeutic targets for preventing or treating infections.

What structural approaches can determine the three-dimensional architecture of HI_1467?

Determining the three-dimensional structure of HI_1467 requires sophisticated approaches suitable for ABC transporter proteins:

X-ray Crystallography Strategy:

  • Protein Engineering for Crystallization:

    • Remove flexible regions that might impede crystal formation

    • Consider fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Generate antibody fragments or nanobodies that stabilize specific conformations

  • Crystallization Optimization:

    • Screen detergents, lipids, and additives systematically

    • Test co-crystallization with ATP analogs (AMPPNP, ADP-beryllium fluoride)

    • Utilize lipidic cubic phase for membrane-associated constructs

  • Data Collection and Processing:

    • Collect high-resolution diffraction data at synchrotron facilities

    • Process data using current crystallographic software suites

    • Consider serial crystallography for microcrystals

Cryo-Electron Microscopy Approach:

  • Sample Preparation:

    • Optimize protein concentration, buffer composition, and grid preparation

    • Consider nanodisc reconstitution to provide a native-like lipid environment

    • Test different detergents and amphipols for stability

  • Data Collection Strategy:

    • Collect data in multiple conformational states by varying nucleotide conditions

    • Use energy filters and phase plates for enhanced contrast

    • Consider tilted data collection to address preferred orientation issues

  • Image Processing:

    • Implement 2D and 3D classification to separate conformational states

    • Apply focused refinement for flexible regions

    • Integrate with other structural data for comprehensive interpretation

NMR Spectroscopy for Dynamics:

  • Focus on specific domains or fragments of HI_1467

  • Use isotopic labeling (¹⁵N, ¹³C, ²H) for larger constructs

  • Apply solution NMR for smaller domains and solid-state NMR for membrane-associated regions

Integrative Structural Biology Approaches:

The integration of these complementary structural approaches can provide a comprehensive understanding of HI_1467's structure-function relationship at molecular resolution.

How can advanced biophysical techniques elucidate the conformational dynamics of HI_1467 during its transport cycle?

Understanding the conformational dynamics of HI_1467 during its transport cycle requires techniques that can monitor structural changes in real-time or capture transient intermediate states:

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Site-directed spin labeling at strategic positions in HI_1467

  • Double Electron-Electron Resonance (DEER) to measure distances between spin labels

  • Continuous Wave EPR to probe accessibility and mobility of labeled sites

  • Fraser Macmillan demonstrated that EPR spectroscopy with site-directed spin labeling can measure distances and probe accessibility in ABC transporters

FRET-based Approaches:

  • Single-molecule FRET to observe individual molecules transitioning between states

  • Time-resolved FRET to capture kinetics of conformational changes

  • Acceptor photobleaching FRET for quantitative distance measurements

  • FRET sensors designed to report on specific conformational changes

Time-resolved Structural Methods:

  • Time-resolved X-ray solution scattering (TR-SAXS):

    • Monitor global conformational changes upon ATP binding/hydrolysis

    • Millisecond time resolution to capture intermediates

  • Temperature-jump techniques coupled with spectroscopic measurements:

    • Initiate conformational changes and monitor in real-time

    • Determine rates of structural transitions

  • Stopped-flow spectroscopy with intrinsic or extrinsic fluorescence:

    • Follow conformational changes with millisecond resolution

    • Correlate structural transitions with biochemical events

Advanced Mass Spectrometry:

  • Hydrogen-Deuterium Exchange (HDX-MS):

    • Identify regions that undergo conformational changes during the transport cycle

    • Time-resolved HDX to capture transient states

  • Ion Mobility Mass Spectrometry:

    • Separate different conformational states based on their collision cross-section

    • Monitor shifts in conformational equilibria upon ligand binding

Computational Methods Integration:

  • Molecular Dynamics Simulations:

    • Simulate complete transport cycles using enhanced sampling techniques

    • Identify water and ion pathways during transport

  • Markov State Models:

    • Integrate experimental data with simulations

    • Map the energy landscape of the transport cycle

  • Normal Mode Analysis:

    • Identify collective motions relevant to transport function

    • Predict conformational changes with minimal computational cost

By combining these techniques, researchers can develop a dynamic model of HI_1467's conformational cycle, correlating structural changes with specific steps in the transport mechanism. This approach aligns with studies of other ABC transporters where conformational dynamics data complemented static structural snapshots .

How does HI_1467 compare to homologous ABC transporters in other bacterial species?

A comprehensive comparative analysis of HI_1467 with homologs from other species can provide valuable evolutionary and functional insights:

Sequence-Based Comparative Analysis:

  • Multiple Sequence Alignment:

    • Align HI_1467 with homologs from diverse bacterial species

    • Identify highly conserved regions likely essential for function

    • Detect species-specific variations that might indicate adaptation

  • Phylogenetic Analysis:

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Determine if HI_1467 clusters with functionally characterized transporters

    • Identify potential horizontal gene transfer events

  • Conservation Analysis:

    • Calculate conservation scores for each amino acid position

    • Map conservation onto structural models to identify functional hotspots

    • Compare conservation patterns of interface residues versus core residues

Structural Comparison:

  • Homology Modeling:

    • Use structures of related ABC transporters as templates

    • Compare predicted structural features across different species

    • Identify structural variations in substrate-binding regions

  • Domain Architecture Analysis:

    • Compare organization of functional domains across species

    • Identify species-specific insertions or deletions

    • Assess differences in linker regions between domains

Functional Conservation:

  • Motif Analysis:

    • Compare canonical ABC transporter motifs (Walker A, Walker B, signature motif)

    • Identify variations that might affect ATP binding/hydrolysis

    • Analyze substrate-specificity determining regions

  • Substrate Prediction:

    • Compare with homologs of known substrate specificity

    • Identify variations in residues lining the putative substrate pathway

    • Predict substrate class based on conserved binding site characteristics

Genomic Context Comparison:

  • Operon Structure Analysis:

    • Compare organization of genes surrounding HI_1467 across species

    • Identify conserved gene clusters suggesting functional relationships

    • Detect co-evolution with specific metabolic pathways

  • Regulatory Element Comparison:

    • Analyze promoter regions for conserved regulatory motifs

    • Compare expression patterns in different species under similar conditions

    • Identify species-specific regulatory mechanisms

This comparative approach can reveal evolutionary adaptations specific to H. influenzae and identify conserved features that suggest core functional mechanisms shared across bacterial ABC transporters.

What can comparative genomics tell us about the potential function and evolution of HI_1467?

Comparative genomics provides powerful insights into the function and evolution of uncharacterized proteins like HI_1467:

Genomic Context Analysis:

SpeciesGenomic NeighborhoodPredicted Function
H. influenzaeGenes A, B, CPotential function X
H. parainfluenzaeGenes A, B, DPotential function X
E. coliGenes E, F, GDifferent function Y
P. aeruginosaNo clear homolog-
  • Operon Structure Examination:

    • Identify whether HI_1467 is part of an operon in H. influenzae

    • Determine if the operon structure is conserved across related species

    • Analyze whether co-transcribed genes suggest functional pathways

  • Gene Neighborhood Conservation:

    • Map genes surrounding HI_1467 in H. influenzae

    • Compare these neighborhoods across different bacterial species

    • Identify synteny blocks that might indicate functional units

  • Co-occurrence Patterns:

    • Determine which genes consistently appear with HI_1467 homologs

    • Analyze whether these genes have known functions that could relate to HI_1467

    • Apply statistical approaches to identify significant co-occurrence relationships

Evolutionary Analysis:

  • Selective Pressure Analysis:

    • Calculate dN/dS ratios to identify positions under positive or purifying selection

    • Determine if substrate-binding regions show evidence of adaptive evolution

    • Compare selection patterns between pathogenic and non-pathogenic species

  • Gene Duplication and Loss Events:

    • Identify paralogs of HI_1467 within the H. influenzae genome

    • Map duplication and loss events across the bacterial phylogeny

    • Determine if gene duplication correlates with functional diversification

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content and codon usage bias for evidence of recent transfer

    • Examine phylogenetic incongruence as an indicator of horizontal transfer

    • Determine if transfer events correlate with acquisition of new ecological niches

Integrated Functional Prediction:

  • Domain Fusion Analysis:

    • Identify cases where HI_1467 homologs are fused with other domains

    • Use these fusion events to infer functional relationships

  • Phylogenetic Profiling:

    • Correlate the presence/absence of HI_1467 with specific phenotypes

    • Identify species lacking HI_1467 and analyze their alternative strategies

  • Pathway Reconstruction:

    • Place HI_1467 in the context of metabolic or signaling pathways

    • Identify gaps or variations in these pathways across species

By integrating these comparative genomics approaches, researchers can develop testable hypotheses about HI_1467's function and understand how selective pressures have shaped its evolution across bacterial species.

How might targeting HI_1467 contribute to new therapeutic strategies against H. influenzae infections?

Exploring HI_1467 as a potential therapeutic target requires a systematic evaluation of its druggability and importance in pathogenesis:

Target Validation Assessment:

  • Essentiality Analysis:

    • Determine if HI_1467 is essential for growth using conditional knockout systems

    • Assess growth defects in different media compositions

    • Evaluate fitness contributions during infection using in vivo models

  • Role in Virulence:

    • Investigate whether HI_1467 deletion affects epithelial cell adhesion/invasion

    • Determine if it contributes to resistance against host defenses

    • Assess if HI_1467 is upregulated during infection

  • Contribution to Antibiotic Resistance:

    • Evaluate whether HI_1467 contributes to efflux of antimicrobial compounds

    • Determine if deletion increases susceptibility to specific antibiotics

    • Assess expression changes in response to antibiotic exposure

Therapeutic Strategy Development:

Targeting ApproachPotential AdvantagesTechnical Challenges
Direct inhibition of ATPase activityDisrupts energy coupling mechanismSelectivity against human ABC transporters
Allosteric inhibitionMay offer greater selectivityIdentifying allosteric sites
Substrate binding pocket targetingHigh specificity potentialRequires substrate identification
Protein-protein interaction disruptionNovel mechanism of actionComplex binding interfaces
  • Structure-Based Drug Design:

    • Identify druggable pockets through computational analysis

    • Design competitive inhibitors of ATP binding

    • Develop allosteric inhibitors that prevent conformational changes

  • Fragment-Based Approaches:

    • Screen fragment libraries against purified HI_1467

    • Identify binding hotspots through NMR or X-ray crystallography

    • Grow fragments into lead compounds

  • Natural Product Screening:

    • Test microbial natural products with known activity against other ABC transporters

    • Focus on compounds with selective activity against bacterial versus human transporters

    • Identify scaffold classes with activity against HI_1467

Therapeutic Application Considerations:

  • Combination Therapy Potential:

    • Assess synergy between HI_1467 inhibitors and conventional antibiotics

    • Determine if inhibition sensitizes resistant strains to antibiotics

    • Design dual-targeting molecules that inhibit multiple essential processes

  • Delivery Challenges:

    • Develop formulations appropriate for respiratory infections

    • Consider permeability across the H. influenzae outer membrane

    • Design inhaled formulations for direct delivery to the site of infection

  • Resistance Development Risk:

    • Assess the frequency of resistance development

    • Identify potential resistance mechanisms

    • Design inhibitor combinations to reduce resistance emergence

The therapeutic value of targeting HI_1467 would ultimately depend on experimental validation of its importance in H. influenzae virulence or survival during infection.

What advanced methodologies will be critical for fully characterizing the structure-function relationship of HI_1467?

Fully elucidating the structure-function relationship of HI_1467 requires integration of cutting-edge methodologies across multiple disciplines:

Structural Biology Integration:

  • Cryo-EM for Conformational Ensemble Analysis:

    • Capture multiple conformational states during the transport cycle

    • Utilize advances in sample preparation and image processing

    • Achieve near-atomic resolution of the complete transporter complex

  • Integrative Modeling Approaches:

    • Combine data from multiple experimental sources (cryo-EM, crystallography, SAXS, EPR)

    • Develop computational frameworks to integrate diverse structural constraints

    • Generate comprehensive models of the complete transport cycle

  • Time-Resolved Structural Methods:

    • Apply time-resolved cryo-EM to capture transient intermediates

    • Utilize X-ray free-electron laser (XFEL) technology for dynamics studies

    • Implement temperature-jump methods to synchronize conformational changes

Functional Assay Innovations:

  • Single-Molecule Transport Assays:

    • Develop fluorescence-based methods to observe individual transport events

    • Correlate ATP hydrolysis with substrate translocation at the single-molecule level

    • Measure kinetic parameters without ensemble averaging

  • High-Throughput Substrate Screening:

    • Design biosensor systems for real-time detection of transport

    • Implement microfluidic systems for rapid assessment of multiple conditions

    • Develop cell-based reporters for in vivo transport activity

  • Nanoscale Measurement Technologies:

    • Apply solid-state nanopore technology to measure transport in artificial membranes

    • Utilize atomic force microscopy to observe conformational changes

    • Implement nanoscale thermophoresis for binding studies

Computational Method Advancement:

Computational ApproachApplication to HI_1467Expected Insights
Molecular DynamicsSimulation of complete transport cycleConformational pathways, energy landscapes
Machine LearningPrediction of substrate specificityNew potential substrates, activity patterns
Quantum Mechanics/Molecular MechanicsATP hydrolysis mechanismChemical mechanism details, transition states
  • Enhanced Sampling Techniques:

    • Apply metadynamics to explore conformational landscapes

    • Use replica exchange methods to overcome energy barriers

    • Implement biased simulations to study rare transport events

  • Multi-scale Modeling:

    • Combine quantum mechanical calculations for the ATPase site

    • Use coarse-grained models for large-scale conformational changes

    • Integrate with cellular-scale models to understand physiological context

  • Network Analysis:

    • Map allosteric communication pathways within the protein

    • Identify critical residues for information transfer between domains

    • Predict effects of mutations on coupling efficiency

By integrating these advanced methodologies, researchers can develop a comprehensive understanding of how HI_1467's structure enables its function, how conformational changes couple ATP hydrolysis to substrate transport, and how this ABC transporter contributes to H. influenzae physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.