Recombinant Haemophilus influenzae Uncharacterized glycosyltransferase HI_1698 (HI_1698)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize fulfilling this request.
Synonyms
HI_1698; Uncharacterized glycosyltransferase HI_1698
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1698
Target Protein Sequence
MKKIGFFIMNIGSAGGTERVSINVANALAKQGYDVSFISIGGNKPFFQVDEKINIYAMNK LPYSLKKDYFSITKKLRELVKELQLDTLIVVDGAIMLFSALALVNLNIKHILWEHYSFNF TGNRLVRTLGKYLAVTTCDKIVTLTEAEKTLWQEKFKTNNIISIANPNTLLPKNKLAKLE NKTILSVGHLFSYKGFDYLLKVWQVLAKKYPDWNLKIVGSGEEEENLKNLAKALDIEDSV NFIPRTNDVSFYYESSSIYCLPSQTEGLPLVVIEAMAFGLPIVAFNCSPGVKQLVEHKEN GFLCEQNNIEEMVKGLDLLINNPELYLQMSDKSRLMSEDYGIEKIIEEWKGIL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1698

STRING: 71421.HI1698

Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is HI_1698 potentially involved in LPS biosynthesis?

While the specific role of HI_1698 in lipopolysaccharide (LPS) biosynthesis has not been directly characterized, its classification as a glycosyltransferase suggests potential involvement in this critical pathway. H. influenzae LPS consists of lipid A, a core oligosaccharide, and in some cases, additional glycoforms that contribute to bacterial virulence and immune evasion.

The H. influenzae genome contains several loci involved in LPS biosynthesis, including the hmg (high-molecular-weight glycoform) locus, which contains multiple glycosyltransferases responsible for the synthesis of cryptic glycoforms . These cryptic glycoforms involve the addition of tetrasaccharide units to the normal core glycoforms. The hmg locus contains several genes with homology to glycosyltransferases involved in O-antigen synthesis or capsule polysaccharide biogenesis in other bacteria .

Given its enzymatic classification, HI_1698 might be involved in:

  • Core oligosaccharide assembly - adding specific sugars to the growing core oligosaccharide

  • Cryptic glycoform synthesis - potentially involved in the synthesis or addition of tetrasaccharide units

  • LPS modification - adding or modifying specific sugar residues that impact host interaction or immune evasion

To determine HI_1698's specific role, experimental approaches similar to those used for other LPS biosynthesis genes would be necessary, including gene knockout studies and detailed structural analysis of LPS from wild-type and mutant strains .

What is the genomic context of HI_1698 in H. influenzae?

The genomic context of genes often provides valuable insights into their function, especially if they are part of operons or gene clusters involved in related processes. While the search results don't explicitly detail the genomic neighbors of HI_1698, understanding its context would be valuable for inferring its function.

To determine HI_1698's genomic context, researchers would typically:

  • Analyze the genes flanking HI_1698 in the H. influenzae genome

  • Determine if it's part of an operon by analyzing promoter regions and transcriptional patterns

  • Examine whether nearby genes have related functions, particularly in carbohydrate metabolism or LPS biosynthesis

What are the most effective methods for expressing and purifying recombinant HI_1698?

Based on available data, recombinant HI_1698 can be successfully expressed and purified, though specific optimization strategies may be necessary to overcome challenges common to glycosyltransferases. Related H. influenzae glycosyltransferases have shown solubility issues at high concentrations, suggesting this may be a consideration for HI_1698 as well .

A comprehensive expression and purification strategy should include:

Expression System Selection:

  • Escherichia coli is commonly used for recombinant protein expression of H. influenzae proteins

  • BL21(DE3) or Rosetta strains may be appropriate based on codon usage in the HI_1698 gene

  • His-tagged constructs have been successfully used for HI_1698 expression

Expression Conditions:

  • Optimization of induction conditions (temperature, IPTG concentration, duration)

  • Testing different growth media to maximize protein yield

  • Potential co-expression with chaperones if solubility issues arise

Purification Protocol:

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Additional purification steps such as ion-exchange or size-exclusion chromatography

  • Buffer optimization, potentially including Tris-based buffer with 50% glycerol as used for commercial preparations

Storage Considerations:

  • Store at -20°C for long-term storage or -80°C for extended conservation

  • Use working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

Optimization ParameterConsiderations
Expression temperature16-37°C, with lower temperatures potentially improving solubility
Induction conditions0.1-1.0 mM IPTG, 3-16 hours induction
Buffer compositionTris-based buffer with glycerol and potential stabilizing additives
Storage-20°C or -80°C with glycerol as cryoprotectant

Addressing solubility challenges will likely be crucial for successful purification of active HI_1698, as noted with other H. influenzae glycosyltransferases .

What experimental approaches can be used to identify substrates and products of HI_1698?

Identifying the substrates and products of an uncharacterized glycosyltransferase requires systematic approaches combining biochemical, analytical, and genetic techniques. For HI_1698, the following complementary methods would be valuable:

Biochemical Screening:

  • Screen a panel of potential acceptor molecules, including LPS precursors, glycoproteins, and oligosaccharides

  • Test various UDP-activated sugars as potential donors

  • Use high-throughput formats (e.g., glycan arrays) to accelerate screening

Analytical Techniques:

  • Mass spectrometry (MS) to detect mass shifts indicating glycosylation

  • Nuclear Magnetic Resonance (NMR) spectroscopy to determine linkage specificity

  • High-Performance Liquid Chromatography (HPLC) to separate and identify reaction products

Genetic Approaches:

  • Generate HI_1698 knockout mutants and analyze changes in glycoconjugate profiles

  • Analyze LPS structure in wild-type versus mutant strains using MS and other techniques

  • Complement mutations to confirm phenotypes are due to HI_1698 disruption

Structural Biology:

  • If structural data becomes available, use molecular docking to predict substrate binding

  • Co-crystallization with substrate analogs or inhibitors to confirm binding modes

Metabolomics:

  • Compare metabolite profiles between wild-type and HI_1698 mutant strains

  • Identify accumulating substrates or missing products that suggest HI_1698 function

Each approach provides complementary information, and integration of multiple methods would provide the most comprehensive understanding of HI_1698's biochemical function. Similar approaches have been used successfully to characterize other glycosyltransferases involved in LPS biosynthesis in H. influenzae .

What is the potential role of HI_1698 in H. influenzae virulence and pathogenesis?

As a potential glycosyltransferase involved in LPS biosynthesis, HI_1698 might play significant roles in H. influenzae virulence and pathogenesis. H. influenzae elaborates short-chain LPS that has a documented role in pathogenesis , and modification of LPS structure can significantly impact virulence.

LPS plays several key roles in H. influenzae pathogenesis:

  • Host immune evasion: Modification of LPS can help bacteria evade recognition by host immune receptors

  • Adherence and colonization: LPS contributes to bacterial adherence to host epithelial cells

  • Resistance to host defense mechanisms: Modified LPS can provide resistance to antimicrobial peptides and complement-mediated killing

Research on other H. influenzae genes has demonstrated that DNA repeats can identify novel virulence genes, and phase variation of surface molecules facilitates evasion of host defenses and adaptation to varying microenvironments . Mutation of one LPS-related gene, lgtC, resulted in attenuated virulence in an infant rat model of invasive infection .

To assess HI_1698's role in virulence, the following methodological approaches would be valuable:

Genetic Manipulation:

  • Generate HI_1698 deletion mutants in different H. influenzae strains

  • Create complemented strains to confirm phenotypes

Phenotypic Analysis:

  • Assess changes in LPS structure in mutant strains

  • Evaluate adherence to epithelial cells using methods similar to those described for other H. influenzae proteins

  • Test resistance to serum killing and other host defense mechanisms

In vivo Virulence Assessment:

  • Use animal models such as the infant rat model to compare virulence of wild-type and mutant strains

  • Measure bacterial loads in tissues, host survival, and pathological changes

If HI_1698 is indeed involved in LPS modification, its disruption might lead to attenuated virulence, similar to what has been observed with other LPS biosynthesis genes in H. influenzae .

How does mutation of HI_1698 affect LPS structure and bacterial phenotype?

While the specific effects of HI_1698 mutation have not been directly reported in the search results, methodological approaches for studying LPS mutations in H. influenzae provide a framework for investigation . Based on studies of other LPS biosynthesis genes, we can outline the expected approaches and potential outcomes:

Generation of Mutants:

  • Create HI_1698 mutants using plasmid constructs with antibiotic resistance cassettes

  • Confirm mutations by PCR with locus-specific primers

  • Generate mutations in multiple strain backgrounds (e.g., serotype b strain RM153 and serotype d-derived strain RM118)

LPS Structure Analysis:

  • Isolate LPS from wild-type and mutant strains

  • Compare LPS profiles using SDS-PAGE and silver staining

  • Perform detailed structural analysis using mass spectrometry and other analytical techniques

  • Look for specific changes in glycosylation patterns that might indicate HI_1698's role

Phenotypic Characterization:

  • Assess growth characteristics and colony morphology

  • Test antibiotic susceptibility to determine if outer membrane permeability is affected

  • Evaluate biofilm formation capacity

  • Measure serum resistance and survival in the presence of antimicrobial peptides

  • Quantify adherence to epithelial cells using established adherence assays

If HI_1698 is involved in LPS biosynthesis, its mutation would likely result in altered LPS structure. Depending on the specific modification catalyzed by HI_1698, these structural changes could lead to various phenotypic effects, potentially including reduced virulence, altered host interaction, or changes in antibiotic susceptibility.

Studies of other LPS biosynthesis genes in H. influenzae have shown that mutations can result in the loss of specific LPS glycoforms, affecting the bacterium's ability to evade host immune responses or colonize specific host niches .

What are the challenges in crystallizing HI_1698 and how can they be overcome?

Crystallizing glycosyltransferases like HI_1698 presents several challenges, as evidenced by experiences with other H. influenzae proteins. For instance, purified HMW1C (another H. influenzae glycosyltransferase) precipitated at high concentrations during crystallography attempts , suggesting similar issues might arise with HI_1698.

Key Challenges and Solutions:

ChallengeSolution Strategies
Solubility issues- Optimize buffer conditions (pH, salt, additives)
- Add solubility enhancers like glycerol (as used in commercial preparations)
- Use solubility-enhancing fusion tags
- Employ reductive methylation of surface lysines
Protein flexibility- Design constructs removing flexible termini
- Co-crystallize with substrates or inhibitors
- Use limited proteolysis to identify stable domains
Protein purity- Implement rigorous purification protocols
- Verify homogeneity using size-exclusion chromatography and dynamic light scattering
Crystal contacts- Screen wide range of crystallization conditions
- Use surface entropy reduction
- Consider crystallization with antibody fragments

Alternative Approaches:
If crystallization proves particularly challenging, alternative structural biology methods could be considered:

  • Nuclear Magnetic Resonance (NMR) for smaller domains

  • Cryo-Electron Microscopy (cryo-EM)

  • Small-Angle X-ray Scattering (SAXS) for low-resolution envelopes

  • Homology modeling based on related glycosyltransferases

The current commercial availability of recombinant HI_1698 suggests that expression and purification are feasible, but achieving the high concentrations and homogeneity required for crystallization may require additional optimization. The documented storage conditions (Tris-based buffer with 50% glycerol) provide a starting point for buffer optimization.

How might structural analysis of HI_1698 inform drug development against H. influenzae?

Structural analysis of HI_1698 could significantly advance drug development efforts against H. influenzae by providing insights for rational design of inhibitors. If HI_1698 plays a role in LPS biosynthesis and contributes to virulence, as suggested by studies of other glycosyltransferases , it could represent a valuable target for novel antimicrobial strategies.

Drug Development Applications:

  • Structure-Based Drug Design:

    • Detailed knowledge of the active site architecture would enable virtual screening for small molecule inhibitors

    • Understanding the catalytic mechanism would inform the design of transition-state analogs

    • Identification of allosteric sites could lead to modulators with high specificity

  • Selectivity and Safety:

    • Structural comparison with human glycosyltransferases would highlight unique features for selective targeting

    • Recognition of bacterial-specific binding pockets would reduce off-target effects

  • Resistance Mitigation:

    • Targeting conserved structural elements could reduce the development of resistance

    • Understanding the flexibility of the binding site would inform design of inhibitors less susceptible to resistance mutations

  • Combination Therapies:

    • Structural insights could suggest synergistic targets in related pathways

    • Rational design of multi-target inhibitors affecting multiple steps in LPS biosynthesis

Notably, glycosyltransferases involved in LPS biosynthesis represent attractive drug targets because they are:

  • Often essential or important for virulence

  • Located on the cytoplasmic face of the inner membrane, making them accessible to inhibitors

  • Distinct from human enzymes, allowing for selective targeting

Previous studies have shown that disruption of LPS-related genes like lgtC can attenuate virulence in animal models , suggesting that inhibitors of LPS biosynthesis enzymes could have therapeutic potential. Structural characterization of HI_1698 would provide the foundation for developing such inhibitors through rational design approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.