Recombinant Haemophilus influenzae Uncharacterized membrane protein HI_1629 (HI_1629)

What is the molecular structure of the HI_1629 membrane protein?

The HI_1629 protein (UniProt accession: P45280) from Haemophilus influenzae strain ATCC 51907/DSM 11121/KW20/Rd is currently classified as an uncharacterized membrane protein. The amino acid sequence consists of 212 residues: MNQFFITSINIIKKQEQMEFLIGFFTEYGYWAVLFVLIICGFGVPIPEDITLVSGGVIAGLYPENVNSHLMLLVSMIGGLAGDSCMYWLGRIYGTKILRFRPIRRIVTLQRLRMVREKFSQYGNRVLFVARFLPGLRAPIYMVSGITRRVSYVRFVLIDFCAAIISVPIWIYLGELGAKNLDWLHTQIQKGQIVIYIFIGYLYYSFLEMEKI . Structural characterization would typically involve techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy, which have not yet been reported for this specific protein. Computational prediction methods suggest it contains multiple transmembrane domains characteristic of integral membrane proteins.

How should HI_1629 recombinant protein be stored and handled in laboratory settings?

The recombinant HI_1629 protein should be stored at -20°C for regular use, while extended storage requires conservation at -20°C or -80°C to maintain protein integrity and function . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and activity loss. For working solutions, store aliquots at 4°C for up to one week . When handling the protein, maintain sterile conditions and use appropriate personal protective equipment to prevent contamination and degradation.

What expression systems are suitable for producing recombinant HI_1629?

For membrane proteins like HI_1629, several expression systems can be employed:

When expressing HI_1629, optimization of codon usage for the host organism, incorporation of appropriate tags for purification, and careful selection of detergents for extraction are critical considerations. The expression region 1-212 covering the full-length protein should be targeted , and expression vectors should include appropriate selection markers and promoters compatible with the chosen host system.

What purification strategies work best for HI_1629 membrane protein?

Purification of membrane proteins like HI_1629 requires specialized approaches:

• Membrane isolation: Differential centrifugation to separate cellular compartments.

• Detergent extraction: Selection of appropriate detergents (e.g., DDM, LDAO) to solubilize the protein while maintaining native structure.

• Affinity chromatography: Using engineered tags (His, GST, etc.) for selective binding to affinity matrices.

• Size exclusion chromatography: For further purification and assessment of protein homogeneity.

• Ion exchange chromatography: To separate proteins based on charge differences.

The strategy should be optimized based on the specific properties of HI_1629, including its hydrophobicity profile and predicted isoelectric point. During purification, it's essential to monitor protein stability and activity through appropriate assays to ensure the native conformation is maintained.

What approaches can be used to determine the function of uncharacterized membrane protein HI_1629?

Elucidating the function of HI_1629 requires a multi-faceted approach:

• Bioinformatic analysis: Sequence similarity searches, phylogenetic profiling, and structural prediction to identify potential homologs with known functions.

• Gene knockout/knockdown studies: Creating deletion mutants in H. influenzae and assessing phenotypic changes in growth, virulence, antibiotic susceptibility, or membrane integrity.

• Protein interaction studies: Techniques such as pull-down assays, yeast two-hybrid screens, or cross-linking experiments to identify interacting partners that might suggest functional roles.

• Localization studies: Using fluorescently tagged versions of HI_1629 to determine precise cellular localization, which can provide functional clues.

• Transcriptomic and proteomic analyses: Comparing wild-type and mutant strains under various conditions to identify pathways affected by HI_1629 absence.

For membrane proteins, particular attention should be paid to potential roles in transport, signaling, or structural integrity of the bacterial membrane. The genetic toolkit developed for H. influenzae, including the pTBH plasmid system with fluorescent labeling capabilities, could be valuable for these functional studies .

How might HI_1629 contribute to H. influenzae pathogenesis and drug resistance?

While the specific role of HI_1629 in pathogenesis remains uncharacterized, several experimental approaches can address this question:

• Virulence assays: Compare wild-type and HI_1629 mutant strains in infection models to assess changes in colonization, invasion, or persistence.

• Antibiotic susceptibility testing: Determine if deletion or overexpression of HI_1629 affects minimum inhibitory concentrations of various antibiotics.

• Membrane permeability assays: Assess whether HI_1629 influences uptake of dyes, antibiotics, or other compounds across the outer membrane.

• Host cell interaction studies: Investigate whether HI_1629 affects adhesion to or invasion of host cells, potentially using the recently developed tools for visualizing H. influenzae during infection of airway epithelial cells .

Recent research has identified numerous multi-drug resistant lineages of H. influenzae globally , making the characterization of membrane proteins potentially involved in drug resistance particularly important. The lack of enrichment of specific lineages among disease samples suggests that virulence factors might be widely distributed across the H. influenzae population .

What structural and functional differences exist between HI_1629 and other characterized membrane proteins in H. influenzae?

Comparative analysis of HI_1629 with characterized H. influenzae membrane proteins requires:

• Structural comparison: Using techniques such as circular dichroism, Fourier-transform infrared spectroscopy, or more detailed structural studies to compare secondary and tertiary structural elements.

• Sequence and domain analysis: Identifying conserved motifs or domains that might suggest functional similarity to known proteins.

• Evolutionary analysis: Phylogenetic studies to determine relatedness to other membrane proteins and potential horizontal gene transfer events.

• Expression pattern analysis: Determining whether HI_1629 is constitutively expressed or induced under specific conditions, compared to other membrane proteins.

H. influenzae demonstrates remarkable genomic diversity and phenotypic heterogeneity , which likely extends to its membrane protein repertoire. Understanding the position of HI_1629 within this diversity can provide insights into its potential specialized functions.

How can reporter fusion systems be optimized for studying HI_1629 localization and regulation?

The pTBH (toolbox for Haemophilus) plasmid system offers standardized modules for fluorescent or bioluminescent labeling of H. influenzae proteins . For studying HI_1629:

• Fusion protein design: Create C-terminal and N-terminal fusions with fluorescent proteins, carefully considering linker length and composition to minimize disruption of protein function.

• Promoter selection: Use either the native HI_1629 promoter to maintain physiological expression patterns or inducible promoters for controlled expression.

• Microscopy techniques: Employ advanced imaging methods such as super-resolution microscopy, FRET, or FRAP to study protein dynamics and interactions in living cells.

• Stability assessment: Monitor plasmid stability during experiments, as previous studies have established methods to calculate plasmid curing rates in H. influenzae .

• Co-localization studies: Combine HI_1629 fusions with markers for different subcellular compartments to precisely determine localization.

This approach can be particularly valuable for understanding the role of HI_1629 in the context of mixed infections with multiple H. influenzae strains, which are frequently observed in clinical settings .

What challenges should researchers anticipate when working with recombinant HI_1629?

Researchers working with HI_1629 should prepare for several technical challenges:

• Protein solubility: Membrane proteins often have limited solubility in aqueous solutions, requiring careful optimization of detergent conditions.

• Functional assays: Without known function, designing appropriate activity assays requires creative approaches based on predicted properties.

• Structural instability: Membrane proteins may be unstable when removed from their native lipid environment, necessitating stabilization strategies such as nanodiscs or amphipols.

• Low expression yields: Membrane proteins typically express at lower levels than soluble proteins, potentially requiring scale-up strategies.

• Antibody generation: Developing specific antibodies against membrane proteins can be challenging due to limited exposed epitopes and difficulties in using the proteins as antigens.

Each of these challenges requires systematic optimization and may benefit from approaches that have been successful with other bacterial membrane proteins.

How should researchers approach the validation of protein-protein interactions involving HI_1629?

A comprehensive validation strategy for HI_1629 interactions should include:

• Multiple detection methods: Combine techniques like co-immunoprecipitation, bacterial two-hybrid systems, and surface plasmon resonance for cross-validation.

• Controls for specificity: Include structurally similar but functionally distinct membrane proteins as negative controls.

• Functional validation: Assess whether disrupting the interaction through mutagenesis affects cellular phenotypes.

• In vivo confirmation: Use techniques like FRET, BiFC, or proximity labeling to confirm interactions in living bacteria.

• Domain mapping: Identify specific domains or residues responsible for the interaction through targeted mutagenesis.

When interpreting results, researchers should consider the highly admixed population structure and extensive genomic diversity of H. influenzae , which might lead to strain-specific interaction patterns.

How might HI_1629 contribute to vaccine development strategies against non-typeable H. influenzae?

While the Hib vaccine has significantly reduced invasive Hib disease, it offers no protection against non-typeable (NT) H. influenzae strains, which comprise approximately 91.7% of isolates in certain populations . If HI_1629 proves to be:

• Conserved across NT strains: Analysis of conservation across isolates would determine potential as a broadly protective antigen.

• Surface-exposed: Structural studies and antibody accessibility assays would confirm accessibility to the immune system.

• Immunogenic: Animal studies to assess ability to elicit protective antibodies or cellular immunity.

• Essential for virulence: Functional studies to confirm role in pathogenesis, making it a logical vaccine target.

The development of mixed-strain experimental systems using fluorescently labeled strains could provide valuable platforms for testing vaccine candidates against diverse H. influenzae populations simultaneously.

What role might HI_1629 play in biofilm formation and polymicrobial infections?

Biofilm formation represents an important aspect of H. influenzae pathogenesis, particularly in chronic infections. Investigating HI_1629's role would involve:

• Comparative biofilm assays: Assessing biofilm formation capacity of wild-type vs. HI_1629 mutant strains.

• Mixed-species biofilms: Examining interactions with other respiratory pathogens like Streptococcus pneumoniae or Moraxella catarrhalis.

• In vivo biofilm models: Using animal models of infection to study biofilm dynamics.

• Protein localization in biofilms: Using the fluorescent reporter systems to track HI_1629 distribution within biofilm structures.

Recent studies have revealed bilayer architecture in mixed H. influenzae biofilms and differential antibiotic efficacy correlating with susceptibility of single-species strains . Understanding HI_1629's contribution to these phenotypes could provide insights into persistent infections and treatment strategies.