Recombinant Haemophilus influenzae Uncharacterized metalloprotease HI_0409 (HI_0409)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped on blue ice. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Products are shipped on blue ice. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
HI_0409; Uncharacterized metalloprotease HI_0409
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-475
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0409
Target Protein Sequence
MPVQHVKLARDRRKKRAYIKVGVFFVAILLILTGILLTIKSKPEENSIFSTFDSGEYHEL
NTSPNENSTALQPDENATSYDDELQAKDDEVDEVKLSSDDLDTLPQHAQDALNGLLDAAD
QAIRITDQFSYTVTEGDTLKDVLVLSGLDDSSVQPLIALDPELAHLKAGQQFYWILDKND
NLEYLNWLVSEKEERIYERLEDGKFKRQVIEKKSIWRKEVLKGEIQNSLNSSLREKGLDT
RQISQLSNALQWQVSLRKLKKGTQFAILVSREYLGDKLTGQGNVEALRISSGGKNYYAVQ
AANGRYYNQQGETLGKGFARYPLQRQARVSSPFNPNRRHPVTGRIRPHKGVDFSVSQGTP
VIAPADGTVEKVAYQAGGAGRYVMLRHGREYQTVYMHLSKSLVKAGQTVKKGERIALSGN
TGISTGPHLHYEFHINGRAVNPLTVKLPGTSSGMTSAERKQFLVRVREAERMLKP
Uniprot No.
Target Background
Database Links
KEGG: hin:HI0409
STRING: 71421.HI0409
Protein Families
OapA family; Peptidase M23B family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
