Recombinant Haemophilus influenzae Uncharacterized protein HI_0044 (HI_0044)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_0044; Uncharacterized protein HI_0044
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0044
Target Protein Sequence
MQSRLIVDAQKESLLSTHKVLRNTYFLLGLTMAFSAVVAFISMSLNLPYPNIIVLLVGFY GLLFLTNKLADRPAGILAAFAFTGFMGYTIGPILNMYVARGMEDLIMLAFAGTAIVFFAC SAYVLTTKKDMSFLSSAMFALFIVLLLGMVASFFFQIPALSVAISALFVVFSTMTILYET SNIIHGGETNYIRATVNIYVSIYNLFLSLLRLLSIFSSDE
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0044

STRING: 71421.HI0044

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for recombinant H. influenzae proteins like HI_0044?

Escherichia coli remains the most widely used expression system for H. influenzae proteins due to its rapid growth, high cell density cultivation, relatively inexpensive substrates, and extensive genetic manipulation tools. For proteins like HI_0044, E. coli-based expression under the control of inducible promoters such as T7 has proven effective, as demonstrated with other H. influenzae proteins . The choice of expression system should consider the protein's characteristics - particularly for membrane-associated or lipid-modified proteins which may require special handling. If HI_0044 contains lipid modifications similar to lipoprotein e (P4), specialized approaches may be necessary to maintain functionality .

How can I optimize soluble expression of recombinant HI_0044?

Optimization of soluble expression requires systematic evaluation of multiple variables. Based on experimental design approaches in recombinant protein expression, the following parameters should be considered:

  • Induction temperature: Lower temperatures (20-25°C) often increase soluble protein yield by slowing expression and allowing proper folding

  • Inducer concentration: For IPTG-inducible systems, concentrations between 0.1-1.0 mM should be tested

  • Induction time: 4-16 hours post-induction, depending on temperature

  • Media composition: Consider enriched media with optimal concentrations of yeast extract and tryptone

  • Growth phase at induction: Typically at mid-log phase (OD600 of 0.6-0.8)

These parameters should be tested using factorial design experiments rather than one-at-a-time approaches to identify optimal combinations .

What purification strategy should I employ for HI_0044?

Without specific information on HI_0044's properties, a general approach would include:

  • Initial capture: Affinity chromatography using a fusion tag (His-tag, GST, etc.)

  • Intermediate purification: Ion exchange chromatography based on the protein's predicted isoelectric point

  • Polishing: Size exclusion chromatography

For H. influenzae proteins, a two-step chromatography approach has been shown effective in achieving >75% homogeneity while maintaining function . When designing a purification strategy, consider that N-terminal modifications might affect chromatographic behavior, as observed with lipoprotein e (P4) .

How can I assess the structure-function relationship of HI_0044?

As an uncharacterized protein, establishing structure-function relationships for HI_0044 requires:

  • Sequence analysis: Using bioinformatics to identify conserved domains and predict function

  • Physicochemical characterization: Determining molecular weight (SDS-PAGE), primary structure (MS/MS), pH optimum, and substrate specificity

  • Structural analysis: Circular dichroism for secondary structure, X-ray crystallography or NMR for tertiary structure

  • Functional assays: Developing specific assays based on predicted functions

For H. influenzae proteins, physicochemical characterization has proven valuable in confirming protein identity and functionality following recombinant expression, as demonstrated with phosphomonoesterase characterization . Specific assays should be developed based on predicted functions from homology modeling.

What methods can determine if HI_0044 has enzymatic activity?

To characterize potential enzymatic activity:

  • Sequence-based prediction: Analyze for conserved catalytic domains using databases like Pfam, PROSITE

  • Substrate screening: Test against a panel of potential substrates based on predicted function

  • Activity assays: Measure substrate conversion rates under varied conditions (pH, temperature, cofactors)

  • Inhibitor studies: Test against various inhibitors to characterize catalytic mechanism

For H. influenzae proteins with enzymatic activity, comprehensive characterization typically includes substrate specificity determination, pH optima identification, and inhibitor sensitivity analysis . Without prior knowledge of HI_0044's function, a broader screening approach is necessary.

How should I design experiments to optimize recombinant HI_0044 expression?

Factorial design is recommended over traditional one-variable-at-a-time approaches. For HI_0044 expression optimization:

  • Identify key variables: Based on similar proteins, critical variables likely include temperature, inducer concentration, induction time, and media composition

  • Design factorial experiments: A 2^n factorial design (where n is number of variables) allows efficient screening of multiple factors

  • Analyze statistical significance: Determine which variables and interactions significantly affect expression

  • Conduct validation runs: Confirm optimal conditions with triplicate experiments

Table 1: Example factorial design for HI_0044 expression optimization

RunTemperature (°C)IPTG (mM)Induction time (h)MediaExpected Response
1250.14LBProtein yield (mg/L)
2370.14LBProtein yield (mg/L)
3251.04LBProtein yield (mg/L)
4371.04LBProtein yield (mg/L)
5250.116LBProtein yield (mg/L)
6370.116LBProtein yield (mg/L)
7251.016LBProtein yield (mg/L)
8371.016LBProtein yield (mg/L)

This approach has successfully yielded optimal conditions for other recombinant proteins, producing yields of 250 mg/L of functional protein .

How can I assess whether HI_0044 has proper folding and functionality?

Assessing proper folding and functionality requires multiple complementary approaches:

  • Solubility analysis: Proportion of protein in soluble vs. insoluble fractions

  • Chromatographic behavior: Elution profile compared to native controls

  • Circular dichroism: Secondary structure fingerprint

  • Functional assays: Based on predicted activity

  • Thermal shift assays: To evaluate structural stability

  • Native PAGE or size exclusion chromatography: To assess oligomeric state

Validation methodology should compare the recombinant protein to native protein characteristics where possible, as was done with recombinant P4 protein which confirmed similar biochemical properties to wild-type protein .

How can I address poor solubility of recombinant HI_0044?

Poor solubility is a common challenge with recombinant proteins. Methodological solutions include:

  • Fusion partners: Solubility-enhancing tags like MBP, SUMO, or thioredoxin

  • Co-expression of chaperones: GroEL/GroES, DnaK/DnaJ, or trigger factor

  • Refolding protocols: Inclusion body solubilization followed by controlled refolding

  • Signal sequence modification: As demonstrated with P4 protein, replacing lipid modification signal sequences with secretion signals can enhance solubility

  • Media supplementation: Addition of compatible solutes or osmolytes

For membrane-associated proteins like many H. influenzae lipoproteins, replacing N-terminal lipid modification signals with secretion signals can dramatically improve extraction and solubility while maintaining function .

What strategies can resolve expression toxicity of HI_0044 to E. coli host cells?

If HI_0044 expression is toxic to host cells:

  • Tightly regulated expression: Use systems with minimal leaky expression

  • Specialized host strains: Consider strains designed for toxic proteins (e.g., C41/C43)

  • Lower temperature expression: Reduces metabolic burden and protein production rate

  • Codon harmonization: Adjust rare codons to match host usage without changing amino acid sequence

  • Glucose supplementation: Addition of 1 g/L glucose can suppress basal expression from lac-based promoters

Implementation of these strategies should follow a systematic approach, potentially using factorial design to identify optimal combinations for reduced toxicity while maintaining yield.

How can I investigate HI_0044's potential role in H. influenzae pathogenesis?

To explore potential pathogenic roles:

  • Gene knockout studies: Generate knockout strains and assess virulence in appropriate models

  • Protein localization: Determine cellular localization using immunofluorescence or fractionation

  • Host interaction studies: Assess binding to host cells or extracellular matrix components

  • Immune response evaluation: Measure immunogenicity and protective potential

  • Comparative genomics: Analyze conservation across virulent and non-virulent strains

H. influenzae contains numerous virulence factors, particularly surface-localized proteins that mediate host interactions. Surface lipoproteins like P4 demonstrate enzymatic activity that may contribute to pathogenesis . Similar approaches could reveal whether HI_0044 plays a role in H. influenzae virulence.

What methods are appropriate for studying potential interactions between HI_0044 and host proteins?

To investigate host-protein interactions:

  • Pull-down assays: Using tagged recombinant HI_0044 to identify binding partners

  • Surface plasmon resonance: For kinetic and affinity measurements of specific interactions

  • Yeast two-hybrid screening: To identify potential interacting host proteins

  • Co-immunoprecipitation: From infected cell lysates to confirm physiological interactions

  • Protein microarrays: For high-throughput screening of multiple potential interactions

These methodologies have proven valuable in characterizing interactions between host cells and H. influenzae proteins, which often mediate colonization or invasion of mucosal surfaces .

How might comparative genomics inform the function of HI_0044 across different H. influenzae strains?

Comparative genomic approaches can provide significant insights:

  • Conservation analysis: Determine if HI_0044 is conserved across serotypes, suggesting essential function

  • Polymorphism identification: Identify strain-specific variations that might correlate with virulence

  • Synteny analysis: Examine genomic context for functional clues

  • Expression pattern comparison: Analyze when and where the protein is expressed across strains

H. influenzae contains over 90 different serotypes with varying virulence profiles . Analysis of protein conservation across these serotypes has proven valuable for identifying potential vaccine candidates and understanding pathogenesis mechanisms, as demonstrated with surface proteins like PsaA and PspA .

What novel experimental approaches might accelerate functional characterization of HI_0044?

Emerging technologies offer new opportunities:

  • CRISPR-Cas9 gene editing: For precise genomic modifications to study function

  • Cryo-EM: For structural determination of challenging proteins

  • Interactome mapping: Using proximity labeling techniques like BioID or APEX

  • Single-cell technologies: To understand expression heterogeneity

  • Machine learning: To predict function from sequence and structural features

These approaches could complement traditional biochemical characterization methods and potentially accelerate understanding of HI_0044's role in H. influenzae biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.