Recombinant Haemophilus influenzae Uncharacterized protein HI_0094 (HI_0094)

Shipped with Ice Packs
In Stock

Description

Physicochemical Properties

  • Molecular Weight: Confirmed via SDS-PAGE, matching theoretical predictions .

  • Solubility: Easily extracted from E. coli membranes due to the absence of lipid modifications .

  • Stability: Sensitive to repeated freeze-thaw cycles; optimal storage at -20°C/-80°C .

Use in Basic Research

HI_0094 serves as a tool for studying H. influenzae biology, including:

  • Pathogenesis: Investigating uncharacterized proteins in bacterial colonization or evasion of host immune responses .

  • Vaccine Development: Potential utility in identifying novel antigenic targets .

Research Gaps and Future Directions

Despite commercial availability, HI_0094 remains poorly studied:

  1. Functional Annotation: No evidence links HI_0094 to specific biochemical pathways or virulence mechanisms .

  2. Interaction Networks: No reported interactions with host proteins or bacterial components .

  3. Disease Association: No direct correlation with H. influenzae pathotypes (e.g., nontypeable strains) .

Proposed Research Strategies

  • Bioinformatics: Predictive tools (e.g., homology modeling, domain analysis) to infer potential functions .

  • Proteomics: Co-immunoprecipitation or mass spectrometry to identify binding partners .

  • In Vitro/In Vivo Models: Assessing HI_0094’s role in bacterial adherence or immune evasion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
HI_0094; Uncharacterized protein HI_0094
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0094
Target Protein Sequence
MSELLINDYTRKGFVDGLCLRLPTICIRPGKPNKATSSFVSSIIREPLHGETSICPVAEK MAFSFIKFLGKKKEEWALAITGYVVSIPIVLPILIIFIKAILDLGK
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0094

STRING: 71421.HI0094

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is HI_0094 and why is it significant in Haemophilus influenzae research?

HI_0094 is an uncharacterized protein in Haemophilus influenzae, a gram-negative bacterium known to cause various human infections ranging from mild respiratory conditions to severe invasive diseases such as pneumonia, bacteremia, and meningitis . The significance of studying HI_0094 lies in understanding the complete survival mechanisms of H. influenzae, as recent evidence suggests that regulatory factors directing adaptations to different environments also control virulence determinants that help the bacterium resist and evade immune clearance mechanisms .

While HI_0094 remains uncharacterized, investigating such proteins is crucial to comprehensively understand H. influenzae pathogenesis, as they may play essential roles in bacterial survival in different anatomical sites. Genome-scale approaches have revealed numerous previously unknown genes important for H. influenzae pathogenesis, and HI_0094 could potentially be among these critical factors .

What experimental approaches are recommended for initial characterization of HI_0094?

For initial characterization of HI_0094, a multi-faceted approach incorporating several complementary techniques is recommended:

  • Recombinant expression and purification: Clone the HI_0094 gene into an appropriate expression vector, express in E. coli or another suitable host, and purify using affinity chromatography.

  • Basic biochemical characterization: Determine protein stability, oligomerization state, and post-translational modifications.

  • Structural analysis: Employ circular dichroism (CD) spectroscopy for secondary structure assessment, followed by X-ray crystallography or NMR for detailed structural information.

  • Sequence analysis and homology modeling: Utilize bioinformatic tools to predict functional domains and potential interactions based on sequence homology with characterized proteins .

  • Gene knockout studies: Apply transposon mutagenesis or targeted gene deletion approaches similar to the HITS (high-throughput insertion tracking by deep sequencing) methodology that has been successfully employed for other H. influenzae genes .

This systematic approach provides foundational information about HI_0094's basic properties before proceeding to more advanced functional characterization.

How can researchers effectively produce recombinant HI_0094 for in vitro studies?

Producing recombinant HI_0094 for in vitro studies requires careful optimization of expression and purification protocols:

Table 1: Recommended Expression Systems for Recombinant HI_0094 Production

Expression SystemAdvantagesChallengesRecommended Tags
E. coli BL21(DE3)High yield, rapid growth, cost-effectivePotential inclusion body formation6xHis, GST, MBP
E. coli SHuffleEnhanced disulfide bond formationLower expression levels6xHis, SUMO
Insect cellsSuperior folding, post-translational modificationsTime-consuming, expensive6xHis, FLAG

Optimized Protocol:

  • Gene synthesis and codon optimization for preferred expression system

  • Cloning into a vector with an appropriate fusion tag (6xHis-tag or MBP often work well for uncharacterized proteins)

  • Expression optimization:

    • Test multiple expression temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Examine expression kinetics (4-24 hours)

  • Cell lysis using either sonication or high-pressure homogenization in buffers containing:

    • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

    • 150-300 mM NaCl

    • 5-10% glycerol

    • Protease inhibitors

  • Purification using affinity chromatography followed by size exclusion chromatography

  • Protein quality assessment using SDS-PAGE, Western blotting, and mass spectrometry

When designing expression constructs, consider the predicted structural features of HI_0094 based on bioinformatic analysis, as these may influence solubility and proper folding.

How can HITS methodology be applied to determine the essentiality of HI_0094 in H. influenzae?

The HITS (high-throughput insertion tracking by deep sequencing) methodology can be effectively applied to determine the essentiality of HI_0094 in Haemophilus influenzae through a systematic approach:

  • Generate a comprehensive transposon mutant library: Create a mariner transposon mutant bank in H. influenzae with approximately 75,000 mutants to ensure genome-wide coverage, similar to libraries used in previous studies .

  • Growth under selective conditions: Subject the mutant library to growth under various conditions that mimic different host environments (e.g., nutrient limitation, oxidative stress, human serum exposure).

  • In vivo selection: Introduce the mutant library into appropriate animal models (typically mouse models of pulmonary infection) for 24-hour infection periods to identify genes required for in vivo survival .

  • Deep sequencing and comparative analysis: Extract bacterial DNA from both pre-infection and post-infection populations, then amplify and sequence transposon-genome junctions to identify the location and frequency of insertions.

  • Data analysis: Compare the relative abundance of HI_0094 transposon mutants before and after selection. A significant decrease in HI_0094 mutants would suggest that this gene is important for fitness under the tested conditions.

  • Validation with defined mutants: Create a specific HI_0094 knockout mutant and test its fitness in comparison to wild-type strains to confirm HITS findings .

This approach has successfully identified 135 genes required for optimal growth/survival of H. influenzae in mouse lungs and can be adapted to evaluate HI_0094's importance across different infection models and growth conditions .

What comparative genomic approaches help understand the conservation and evolution of HI_0094 across Haemophilus species?

To understand the conservation and evolution of HI_0094 across Haemophilus species, researchers should implement a comprehensive comparative genomic analysis framework:

  • Sequence retrieval and homology identification:

    • Obtain HI_0094 homolog sequences from all available Haemophilus species and related genera

    • Use reciprocal BLAST searches to confirm orthology relationships

    • Extract both protein-coding sequences and surrounding genomic regions

  • Phylogenetic analysis:

    • Construct multiple sequence alignments using MUSCLE or MAFFT

    • Generate phylogenetic trees using maximum likelihood methods

    • Compare protein phylogeny with species phylogeny to detect potential horizontal gene transfer events

  • Synteny analysis:

    • Examine the conservation of gene order surrounding HI_0094

    • Identify genomic rearrangements that may affect HI_0094 expression or function

    • Map changes in genomic context to the phylogenetic tree

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine whether HI_0094 is under purifying, neutral, or positive selection

    • Identify specific amino acid residues under selection using methods like PAML

    • Compare selection patterns across different Haemophilus lineages

  • Structural conservation mapping:

    • Project sequence conservation onto predicted protein structures

    • Identify conserved surface patches that may indicate functional sites

    • Analyze the conservation of predicted protein-protein interaction interfaces

This comprehensive approach would reveal whether HI_0094 is part of the core genome of Haemophilus species or shows strain-specific adaptations, providing insights into its potential functional importance across the genus .

How does gene expression of HI_0094 vary across different infection sites and conditions?

Understanding HI_0094 expression patterns across different infection sites and conditions requires a combination of transcriptomic approaches and validation techniques:

Table 2: Expression Analysis Methods for HI_0094 Across Different Conditions

ConditionRecommended MethodKey ParametersExpected Outcome
Nasopharyngeal colonizationRNA-Seq, RT-qPCRComparison to in vitro growthBaseline expression profile
Lung infectionIn vivo transcriptomics24-48h post-infection samplesStress response patterns
Systemic infection (blood)RNA-Seq, MicroarrayComparison to respiratory samplesVirulence-associated regulation
Nutrient limitationChemostat culturesCarbon, iron, oxygen restrictionMetabolic adaptation signatures
Biofilm formationComparative proteomicsPlanktonic vs. biofilm cellsStructural protein relationships

To accurately profile HI_0094 expression:

  • In vitro expression analysis: Grow H. influenzae under conditions mimicking different host environments (varying oxygen levels, pH, nutrient availability, presence of host factors) and measure HI_0094 expression using RT-qPCR or RNA-Seq.

  • Host infection models: Recover bacteria from different anatomical sites in animal models (lungs, blood, middle ear) at various time points post-infection for expression analysis, similar to approaches used in previous H. influenzae studies .

  • Single-cell expression analysis: Apply fluorescent reporter constructs or RNA-FISH to examine potential heterogeneity in HI_0094 expression within bacterial populations.

  • Regulatory network mapping: Identify transcription factors controlling HI_0094 expression through ChIP-Seq or promoter analysis, with particular attention to known virulence regulators like ArcA and FNR that have been implicated in H. influenzae adaptation to different environments .

  • Host response correlation: Correlate HI_0094 expression levels with host immune responses to identify potential immunomodulatory functions.

This multi-faceted approach would provide insights into when and where HI_0094 might be functionally important during H. influenzae pathogenesis, guiding further functional characterization efforts.

What experimental design is most effective for determining the cellular localization of HI_0094?

Determining the cellular localization of HI_0094 requires a systematically designed experimental approach combining computational prediction, biochemical fractionation, and microscopy techniques:

  • Computational prediction:

    • Begin with in silico analysis using localization prediction algorithms (PSORT, SignalP, TMHMM)

    • Identify potential localization signals (signal peptides, transmembrane domains, lipidation motifs)

    • Generate testable hypotheses about HI_0094 localization

  • Subcellular fractionation:

    • Perform sequential extraction of cytoplasmic, periplasmic, membrane, and secreted fractions

    • Analyze each fraction by Western blotting using anti-HI_0094 antibodies

    • Include known marker proteins for each compartment as controls

  • Fluorescent protein fusion analysis:

    • Create C-terminal and N-terminal fluorescent protein fusions (e.g., GFP, mCherry)

    • Express in H. influenzae under native promoter control

    • Visualize localization using fluorescence microscopy under different growth conditions

  • Immunogold electron microscopy:

    • Develop specific antibodies against recombinant HI_0094

    • Perform immunogold labeling of ultrathin sections

    • Quantify gold particle distribution across cellular compartments

The experimental design should include proper controls according to established guidelines :

  • Include known proteins with established localizations as positive controls

  • Create several independent biological replicates (minimum of three)

  • Quantify the distribution of signals across cellular compartments

  • Test localization under different growth conditions that mimic various infection sites

This systematic approach provides complementary lines of evidence about HI_0094's subcellular localization, offering insights into its potential function based on where it resides within the bacterial cell .

How can researchers identify potential interaction partners of HI_0094?

Identifying potential interaction partners of HI_0094 requires a multi-technique approach to capture different types of protein-protein interactions:

Table 3: Approaches for Identifying HI_0094 Interaction Partners

TechniqueStrengthsLimitationsKey Experimental Considerations
Affinity Purification-Mass Spectrometry (AP-MS)Identifies stable complexes in native conditionsMay miss transient interactionsTag position, wash stringency, control pulldowns
Bacterial Two-Hybrid (B2H)Tests specific binary interactionsArtificial systemDomain mapping, self-activation controls
Proximity-Dependent Biotin Identification (BioID)Captures transient and proximal interactionsRequires genetic modificationExpression level, labeling time, spatial resolution
Crosslinking Mass Spectrometry (XL-MS)Preserves weak interactions, provides structural insightsComplex data analysisCrosslinker selection, concentration optimization
Co-immunoprecipitation (Co-IP)Confirms interactions in native contextRequires specific antibodiesAntibody specificity, extraction conditions

Implementation strategy:

  • Bait preparation:

    • Express HI_0094 with affinity tags (His, FLAG, or biotin acceptor peptide)

    • Verify functionality of tagged protein

    • Consider both N- and C-terminal tagging approaches to minimize functional interference

  • Interactome mapping:

    • Perform pulldowns from H. influenzae lysates grown under different conditions

    • Identify co-purifying proteins via mass spectrometry

    • Implement SILAC or TMT labeling for quantitative comparison between specific and control pulldowns

  • Validation of interactions:

    • Confirm key interactions using reciprocal pulldowns

    • Perform bacterial two-hybrid or split-protein complementation assays

    • Create domain deletion constructs to map interaction interfaces

  • Functional context analysis:

    • Map interactions to biological pathways using bioinformatics

    • Analyze co-expression patterns across different conditions

    • Assess phenotypic consequences of disrupting specific interactions

This comprehensive approach overcomes the limitations of any single method and provides high-confidence interaction data that can reveal the functional context of HI_0094 within H. influenzae cellular processes .

What methods are appropriate for investigating the role of HI_0094 in H. influenzae virulence?

Investigating the role of HI_0094 in H. influenzae virulence requires a systematic approach combining genetic manipulation, infection models, and virulence assays:

  • Genetic manipulation strategies:

    • Create a clean deletion mutant of HI_0094 using allelic exchange

    • Develop complementation strains expressing HI_0094 from its native promoter

    • Generate point mutants targeting predicted functional domains

    • Create conditional expression strains for studying essential genes

  • In vitro virulence assays:

    • Assess adherence to respiratory epithelial cell lines

    • Measure biofilm formation capacity

    • Evaluate resistance to antimicrobial peptides and oxidative stress

    • Test survival in human serum

  • Infection models:

    • Mouse pulmonary infection model (widely used for H. influenzae virulence studies)

    • Chinchilla model for otitis media investigations

    • Infant rat model for bacteremia studies

    • Cell culture invasion and persistence assays

  • Host response analysis:

    • Measure cytokine/chemokine responses to wild-type versus ΔHI_0094 strains

    • Assess recruitment of immune cells during infection

    • Evaluate tissue damage markers in infection sites

  • In vivo competition assays:

    • Co-infect animal models with wild-type and ΔHI_0094 strains

    • Calculate competitive index to quantify relative fitness

    • Recover bacteria from different anatomical sites to track dissemination

When designing these experiments, it's crucial to include appropriate controls and perform sufficient biological replicates (minimum of three independent experiments with at least three technical replicates each) . The infection models should be carefully selected based on the specific aspect of H. influenzae pathogenesis being investigated, whether it's respiratory colonization, invasive disease, or persistence .

What are the most effective approaches for determining the structure of HI_0094?

Determining the structure of HI_0094 requires a strategic multi-method approach that maximizes the chances of success with this uncharacterized protein:

Table 4: Structural Determination Methods for HI_0094

MethodResolution RangeSample RequirementsAdvantagesChallenges
X-ray Crystallography0.5-3.0 ÅCrystals (mg quantities)Atomic resolution, handles large proteinsCrystallization bottleneck
Cryo-Electron Microscopy2.5-4.0 ÅPurified protein (μg quantities)Works with flexible proteins, minimal sampleLower resolution for small proteins
Nuclear Magnetic Resonance2.0-5.0 ÅIsotope-labeled protein (mg quantities)Solution state, dynamics informationSize limitations (<30 kDa ideal)
Small-Angle X-ray Scattering10-20 ÅMonodisperse samples (mg quantities)Low-resolution envelope, flexible systemsLimited resolution

Recommended workflow:

  • Initial characterization:

    • Assess protein stability and homogeneity using thermal shift assays and size exclusion chromatography

    • Evaluate secondary structure content with circular dichroism spectroscopy

    • Perform limited proteolysis to identify stable domains

  • Crystallization screening:

    • Set up extensive crystallization trials varying protein concentration, buffer conditions, and precipitants

    • Consider surface entropy reduction mutations to promote crystal contacts

    • Try co-crystallization with potential ligands or interaction partners

  • NMR analysis:

    • Produce 15N-labeled protein for HSQC screening to assess feasibility

    • If promising, produce double (13C/15N) or triple (13C/15N/2H) labeled samples

    • Collect standard triple-resonance experiments for backbone and side-chain assignments

  • Cryo-EM approach:

    • Consider if HI_0094 forms larger complexes or oligomers

    • Optimize grid preparation and freezing conditions

    • Collect high-resolution data on state-of-the-art microscopes

  • Integrative modeling:

    • Combine experimental data from multiple methods

    • Incorporate distance constraints from crosslinking mass spectrometry

    • Validate models against experimental data not used in model building

This comprehensive approach maximizes the chances of obtaining structural information for HI_0094 regardless of its particular biochemical properties .

How can researchers characterize the enzymatic activity of HI_0094 if it exhibits catalytic function?

To characterize potential enzymatic activity of HI_0094, researchers should implement a systematic approach combining predictive analysis with experimental validation:

  • In silico prediction of enzymatic function:

    • Perform detailed sequence analysis to identify conserved catalytic motifs

    • Use structure prediction tools (AlphaFold2, RoseTTAFold) to model active sites

    • Examine structural similarity to known enzymes using tools like Dali and CATH

    • Predict potential substrates based on genomic context and pathway analysis

  • Substrate screening approaches:

    • Develop a substrate library based on predicted function

    • Utilize metabolomics to identify changes in metabolite profiles when HI_0094 is overexpressed or deleted

    • Apply activity-based protein profiling with mechanism-based probes

    • Screen against commercial enzyme substrate libraries

  • Enzymatic assay development:

    • Design spectrophotometric, fluorometric, or coupled enzyme assays

    • Optimize reaction conditions (pH, temperature, metal ion requirements)

    • Determine kinetic parameters (Km, kcat, specificity constants)

    • Identify inhibitors to confirm specificity

  • Catalytic mechanism investigation:

    • Perform site-directed mutagenesis of predicted catalytic residues

    • Use isotope labeling to track reaction mechanisms

    • Apply stopped-flow kinetics for transient intermediate detection

    • Analyze enzyme-substrate complexes via X-ray crystallography

Table 5: Experimental Conditions for Optimal Enzymatic Activity Detection

ParameterRange to TestOptimization StrategyControls
pH5.0-9.00.5 unit incrementsBuffer-only reactions
Temperature25-42°C5°C incrementsHeat-inactivated enzyme
Metal ionsMg2+, Mn2+, Zn2+, Ca2+0.1-10 mM concentrationsEDTA chelation control
Substrate concentration0.1-10× estimated KmLog-scale incrementsNo-enzyme controls
Redox environmentReducing/oxidizingDTT, glutathione, H2O2Redox-insensitive enzyme

This comprehensive approach accounts for the challenges of working with an uncharacterized protein and maximizes the chances of correctly identifying and characterizing any enzymatic activity associated with HI_0094 .

What approaches help determine if HI_0094 functions in protein complexes or independently?

Determining whether HI_0094 functions in protein complexes or independently requires a multi-faceted approach:

  • Bioinformatic prediction of protein-protein interactions:

    • Analyze genomic context and operon structure

    • Search for conserved protein domains known to mediate interactions

    • Perform co-evolution analysis to identify potential interaction partners

    • Examine structural features for potential interaction interfaces

  • Native protein complex analysis:

    • Utilize blue native PAGE to preserve native complexes

    • Apply size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Perform analytical ultracentrifugation to determine oligomeric state

    • Use native mass spectrometry to determine complex stoichiometry

  • In vivo complex detection:

    • Implement proximity-dependent labeling (BioID, APEX) in H. influenzae

    • Perform formaldehyde crosslinking followed by immunoprecipitation

    • Apply fluorescence resonance energy transfer (FRET) with tagged proteins

    • Use bacterial two-hybrid assays to test specific interactions

  • Functional dependency testing:

    • Create knockout mutants of predicted complex components

    • Assess epistatic relationships between HI_0094 and partner genes

    • Perform complementation experiments with individual components

    • Test protein stability in the absence of potential partners

  • Structural characterization of complexes:

    • Co-purify HI_0094 with interaction partners

    • Apply negative-stain electron microscopy for initial complex visualization

    • Use cryo-electron microscopy for high-resolution structure determination

    • Perform crosslinking mass spectrometry to map interaction interfaces

When executing these experiments, it's essential to include appropriate controls and carefully validate findings using complementary techniques. For instance, interactions identified through co-immunoprecipitation should be confirmed using reciprocal pulldowns and alternative interaction detection methods .

How can researchers investigate the potential role of HI_0094 in antibiotic resistance mechanisms?

Investigating the potential role of HI_0094 in antibiotic resistance mechanisms requires a comprehensive experimental approach:

  • Genetic association analysis:

    • Compare HI_0094 sequence variations across antibiotic-resistant and susceptible clinical isolates

    • Analyze genomic context for proximity to known resistance determinants

    • Examine transcriptional responses of HI_0094 to antibiotic exposure using RNA-Seq

    • Create knockout and overexpression strains to test causality

  • Phenotypic characterization:

    • Determine minimum inhibitory concentrations (MICs) for various antibiotic classes in wild-type vs. ΔHI_0094 strains

    • Perform time-kill assays to assess the impact on bactericidal activity

    • Evaluate biofilm formation capacity and antibiotic tolerance

    • Assess membrane permeability and efflux pump activity

  • Molecular mechanism exploration:

    • Test direct binding of antibiotics to purified HI_0094 using techniques like isothermal titration calorimetry

    • Examine potential enzymatic modification of antibiotics through mass spectrometry

    • Investigate changes in peptidoglycan structure or outer membrane integrity

    • Analyze protein-protein interactions with known resistance determinants

  • In vivo relevance assessment:

    • Test antibiotic efficacy in animal infection models comparing wild-type and ΔHI_0094 strains

    • Evaluate persistence during antibiotic treatment

    • Analyze emergence of resistance during therapy

    • Correlate findings with clinical outcomes in human infections

Table 6: Experimental Design for Antibiotic Susceptibility Testing

Antibiotic ClassRepresentative AgentsPrimary MeasurementSecondary Assays
β-lactamsAmpicillin, CeftriaxoneMIC, E-testPopulation analysis profile
MacrolidesAzithromycin, ClarithromycinDisk diffusion, MICMacrolide efflux
FluoroquinolonesCiprofloxacin, LevofloxacinMIC, mutation frequencyDNA gyrase interaction
TetracyclinesTetracycline, DoxycyclineMIC, ribosome protectionEfflux pump activity
AminoglycosidesGentamicin, TobramycinMIC, uptake assaysMembrane potential

This systematic approach would reveal whether HI_0094 contributes to antibiotic resistance either directly (through enzymatic modification or target protection) or indirectly (through stress responses or physiological adaptations) .

What approaches can resolve contradictory data regarding HI_0094 function in different experimental systems?

Resolving contradictory data regarding HI_0094 function requires a systematic approach to identify the sources of discrepancies and reconcile findings:

  • Standardization of experimental systems:

    • Establish consistent growth conditions and media formulations

    • Use genetically defined strains with complete genome sequences

    • Implement standardized protocols for key assays

    • Develop reference standards for quantitative measurements

  • Cross-validation across methodologies:

    • Apply orthogonal techniques to address the same biological question

    • Perform replicate studies in independent laboratories

    • Use different experimental models (in vitro, ex vivo, in vivo)

    • Implement both loss-of-function and gain-of-function approaches

  • Context-dependent function analysis:

    • Systematically vary environmental conditions (pH, temperature, nutrients)

    • Test function across different growth phases

    • Examine strain-specific differences in HI_0094 function

    • Consider interactions with host factors

  • Detailed molecular characterization:

    • Create a series of truncation and point mutants

    • Map functional domains with precision

    • Examine post-translational modifications across conditions

    • Determine strain-specific sequence variations

  • Meta-analysis and integrative approaches:

    • Pool raw data across studies for re-analysis

    • Apply statistical methods to identify sources of variation

    • Develop mathematical models to explain context-dependent functions

    • Integrate multi-omics data to place contradictory results in broader biological context

When investigating contradictions, it's essential to consider:

  • Genetic background effects: Test HI_0094 function in multiple H. influenzae strains, including laboratory reference strains and clinical isolates .

  • Environmental dependencies: Examine HI_0094 function under conditions that mimic different infection sites, such as the nasopharynx, lungs, blood, and middle ear .

  • Functional redundancy: Identify proteins with overlapping functions that might mask phenotypes in single-gene studies.

  • Technical limitations: Assess whether assay sensitivity, specificity, or dynamic range could explain contradictory results.

This comprehensive approach would help distinguish genuine biological complexity from experimental artifacts and provide a more nuanced understanding of HI_0094 function .

How can systems biology approaches integrate HI_0094 into broader H. influenzae pathogenesis networks?

Integrating HI_0094 into broader H. influenzae pathogenesis networks through systems biology approaches requires a comprehensive multi-omics strategy:

  • Multi-omics data integration:

    • Generate coordinated transcriptomic, proteomic, and metabolomic datasets across infection-relevant conditions

    • Include wild-type and ΔHI_0094 strains to identify differential responses

    • Apply network inference algorithms to identify co-regulated genes and proteins

    • Construct genome-scale metabolic models incorporating HI_0094

  • Network analysis approaches:

    • Perform weighted gene co-expression network analysis (WGCNA)

    • Identify network motifs and regulatory hubs

    • Calculate centrality measures to assess HI_0094's network importance

    • Apply machine learning for pathway prediction and network visualization

  • Perturbation experiments:

    • Conduct systematic genetic interaction screens (e.g., transposon insertion sequencing)

    • Implement chemical genomics with antimicrobials and host-derived factors

    • Apply CRISPR interference for targeted network perturbation

    • Develop inducible expression systems for time-resolved network analysis

  • Host-pathogen interaction modeling:

    • Incorporate host transcriptomic responses to infection

    • Model immune system interactions with bacterial virulence networks

    • Develop agent-based models of infection dynamics

    • Identify critical nodes where HI_0094 influences host-pathogen interfaces

  • Predictive modeling and validation:

    • Develop mathematical models of HI_0094-associated pathways

    • Make testable predictions about system behavior under new conditions

    • Validate model predictions with targeted experiments

    • Refine models iteratively based on new data

Table 7: Data Types for Systems Biology Integration of HI_0094

Data TypeKey TechnologiesAnalysis ApproachesIntegration Method
TranscriptomicsRNA-Seq, tiling arraysDifferential expression, co-expression networksMulti-factor analysis
ProteomicsLC-MS/MS, SILACProtein-protein interactions, post-translational modificationsBayesian network models
MetabolomicsTargeted LC-MS, NMRPathway enrichment, flux balance analysisConstraint-based modeling
PhenomicsGrowth profiles, virulence assaysPhenotypic clustering, epistasis mappingMachine learning classifiers
InteractomicsAP-MS, Y2H, BioIDInteraction network topologyNetwork alignment algorithms

This comprehensive systems biology approach would place HI_0094 in its proper biological context, revealing its contributions to H. influenzae adaptation and pathogenesis across different host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.