Recombinant Haemophilus influenzae Uncharacterized protein HI_0096 (HI_0096)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

The protein exhibits stability in Tris/PBS-based buffer (pH 8.0) with 6% trehalose cryoprotectant . Key handling characteristics include:

  • Reconstitution: Requires sterile deionized water at 0.1-1.0 mg/mL

  • Additive recommendation: 5-50% glycerol for long-term storage

  • Working aliquots: Stable at 4°C for ≤7 days

Research Applications

Current verified applications focus on:

  • SDS-PAGE analysis for purity verification

  • Antigen production for antibody development

  • Structural studies (crystallization trials)

While pathway participation remains uncharacterized, comparative analysis with other Haemophilus proteins suggests potential roles in:

  • Bacterial adhesion mechanisms

  • Host immune system modulation

  • Metabolic regulation

Experimental Considerations

Critical handling parameters:

ParameterOptimal Condition
CentrifugationBrief spin before vial opening
Aliquot sizeSingle-use portions recommended
Buffer compatibilityCompatible with most ionic solutions
Denaturing conditionsAvoid >0.5% SDS concentrations

Current Research Limitations

Despite commercial availability , significant knowledge gaps persist:

  • No confirmed enzymatic activity

  • Unknown membrane localization (despite predicted lipoprotein features)

  • Uncharacterized post-translational modifications

  • Undetermined oligomerization state

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_0096; Uncharacterized protein HI_0096
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0096
Target Protein Sequence
MDLADSQITQGNEIIQSMGLTNVRLLEYFIYQVGSFTIQSLTQHIEENKEFANITENELY SAVLSLVILGYVYVYLTTYPIYSFEDNKTYIPKSFTQYVKTLVEGANQYIGAGNMYNGDV EDLNKLHLYIMSQMEKPTTKAELKSALQGYLIQNEYQDMNNNDKLIDETYDCTELFNALF DVLTRLGISSL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0096

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Haemophilus influenzae Uncharacterized Protein HI_0096?

HI_0096 is a conserved hypothetical protein (CHP) from Haemophilus influenzae strain ATCC 51907/DSM 11121/KW20/Rd with UniProt accession number P43940. The protein consists of 146 amino acids with the sequence beginning with MDLADSQITQ and contains hydrophobic regions suggesting potential membrane association . As an uncharacterized protein, its precise biological function remains unknown, placing it among the substantial fraction of prokaryotic proteomes (~20-40%) classified as hypothetical proteins requiring functional validation through combined computational and experimental approaches .

What computational approaches should I use for initial functional prediction of HI_0096?

A systematic computational workflow is recommended for HI_0096 functional prediction:

  • Sequence-based analysis: Begin with homology searches using BLAST against non-redundant protein databases, followed by multiple sequence alignment to identify conserved domains and motifs .

  • Structural prediction: Apply tools such as I-TASSER, Phyre2, or AlphaFold to generate predicted tertiary structures, which often provide functional insights when sequence similarity searches yield limited results .

  • Subcellular localization prediction: Use algorithms like PSORT, CELLO, or SignalP to determine potential cellular compartmentalization, which provides context for potential functions .

  • Functional domain analysis: Apply InterProScan, SMART, or Pfam to identify potential functional domains, active sites, or binding regions .

Table 1: Recommended computational tools for HI_0096 analysis

Analysis TypeRecommended ToolsInformation Obtained
HomologyBLAST, HHpredSequence similarity to characterized proteins
Domain AnalysisInterProScan, Pfam, SMARTFunctional domains and motifs
Structural PredictionI-TASSER, Phyre2, AlphaFold3D structure prediction
Subcellular LocalizationPSORT, CELLO, SignalPCellular compartment prediction
Protein-Protein InteractionSTRINGPotential interaction partners

What experimental methods should I use for initial characterization of recombinant HI_0096?

For initial experimental characterization, employ a systematic approach combining:

  • Recombinant protein expression optimization: Based on methods used for other H. influenzae proteins, express HI_0096 using a T7-inducible promoter system after replacing any potential N-terminal lipid modification signal sequence with a protein secretion sequence to enhance purification yields .

  • Protein purification strategy: Implement a two-step chromatography approach, beginning with affinity chromatography (if expressed with a tag) followed by gel filtration chromatography to achieve apparent homogeneity .

  • Basic biochemical characterization: Determine molecular weight via SDS-PAGE, confirm protein identity through mass spectrometry, and evaluate basic physicochemical properties including pH optimum for activity and thermal stability .

  • Activity screening: Perform enzymatic assays for common biochemical activities (phosphatase, protease, kinase activities) to identify potential functions before proceeding to more targeted experimental approaches .

How can I optimize expression and purification of recombinant HI_0096?

To maximize recombinant HI_0096 expression and purification:

  • Expression system selection: Based on successful approaches with other H. influenzae proteins, use E. coli BL21(DE3) with the pET expression system under T7 promoter control. If membrane association is suspected, consider fusion partners that enhance solubility (SUMO, MBP, or Thioredoxin) .

  • Expression optimization: Systematically test:

    • Induction conditions: IPTG concentration (0.1-1.0 mM)

    • Growth temperature post-induction (16°C, 25°C, 37°C)

    • Media composition (LB, TB, auto-induction media)

    • Induction duration (3h, 6h, overnight)

  • Extraction optimization: If HI_0096 contains hydrophobic regions, evaluate different extraction buffers:

    • Non-ionic detergents (0.5-2% Triton X-100, NP-40)

    • Mild ionic detergents (0.1-0.5% sodium deoxycholate)

    • Chaotropic agents at low concentrations (1-2M urea)

  • Purification strategy: Implement sequential chromatography:

    • Primary: Affinity chromatography (Ni-NTA for His-tagged constructs)

    • Secondary: Ion-exchange chromatography (based on theoretical pI)

    • Tertiary: Gel filtration for polishing and buffer exchange

Monitor protein homogeneity at each step using SDS-PAGE and Western blotting. For optimal results, maintain cold chain (4°C) throughout purification and include protease inhibitors in all buffers .

What structural analysis techniques are most appropriate for HI_0096 characterization?

A multi-technique approach is recommended for structural characterization of HI_0096:

  • Secondary structure analysis:

    • Circular Dichroism (CD) spectroscopy to determine α-helix, β-sheet, and random coil content

    • Fourier Transform Infrared Spectroscopy (FTIR) as a complementary method for secondary structure verification

  • Tertiary structure determination:

    • X-ray crystallography: Attempt crystallization screening with commercial kits designed for membrane-associated proteins if bioinformatic analysis suggests membrane localization

    • Nuclear Magnetic Resonance (NMR): For structural determination in solution if protein size permits (<30 kDa)

    • Cryo-electron microscopy: Particularly valuable if HI_0096 forms multimeric complexes

  • Dynamics and stability analysis:

    • Differential Scanning Calorimetry (DSC) to analyze thermal stability

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to probe conformational dynamics and ligand binding surfaces

When presenting structural data, ensure thorough validation through tools such as MolProbity, PROCHECK, or wwPDB validation services before drawing functional inferences .

How can I investigate protein-protein interactions involving HI_0096?

To comprehensively characterize the interactome of HI_0096:

  • In silico prediction: Use computational tools such as STRING, which combines multiple sources of evidence (genomic context, co-expression, text mining) to predict functional associations .

  • Affinity-based methods:

    • Pull-down assays using tagged recombinant HI_0096

    • Co-immunoprecipitation with antibodies against HI_0096

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Biophysical interaction analysis:

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for interactions with minimal sample consumption

  • Cell-based methods:

    • Bacterial two-hybrid systems adapted for H. influenzae proteins

    • Fluorescence Resonance Energy Transfer (FRET) for studying interactions in near-native environments

    • Proximity-dependent biotin identification (BioID) for detecting proximal proteins in vivo

For each detected interaction, implement validation through reciprocal experiments and functional assays to distinguish physiologically relevant interactions from experimental artifacts .

What approaches should I use to validate predicted functions of HI_0096?

Function validation requires a multi-faceted approach combining:

  • Gene knockout/knockdown studies:

    • Generate deletion mutants of HI_0096 in H. influenzae

    • Perform comprehensive phenotypic analysis including growth curves, stress responses, and virulence assays

    • Complement with wild-type gene to confirm phenotype specificity

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Focus on predicted active sites from structural analysis

    • Evaluate mutant proteins for altered activity, stability, or interaction profiles

  • In vitro biochemical assays:

    • Design activity assays based on computational predictions

    • Test substrate specificity systematically

    • Determine enzyme kinetics if catalytic activity is observed

  • Cellular localization:

    • Generate fluorescent protein fusions

    • Perform immunolocalization studies with antibodies against HI_0096

    • Conduct subcellular fractionation followed by Western blotting

Table 2: Functional validation experimental design matrix

Computational PredictionValidation ApproachExpected OutcomeControls
Enzymatic activityIn vitro biochemical assays with predicted substratesKinetic parameters (Km, Vmax)Heat-inactivated protein
Protein-protein interactionPull-down assays with predicted partnersCo-purification of interacting proteinsGST-tag only control
Membrane associationMembrane fractionationEnrichment in membrane fractionCytoplasmic protein control
Stress response roleGrowth under stress conditions with knockout strainAltered growth/survival phenotypeWild-type strain, complemented strain

How can I analyze post-translational modifications of HI_0096?

A systematic workflow for PTM analysis includes:

  • Prediction of potential modifications:

    • Use tools like NetPhos for phosphorylation sites

    • NetOGlyc/NetNGlyc for glycosylation

    • GPS-SUMO for SUMOylation

    • NetAcet for acetylation

  • Mass spectrometry-based identification:

    • Employ bottom-up proteomics with enzymatic digestion

    • Use enrichment strategies specific to modification type (e.g., TiO2 for phosphopeptides)

    • Implement Electron Transfer Dissociation (ETD) or Electron Capture Dissociation (ECD) fragmentation methods for labile modifications

  • Site-specific validation:

    • Generate site-directed mutants of predicted modification sites

    • Use modification-specific antibodies for Western blotting

    • Perform direct comparison of modified vs. unmodified protein properties

  • Functional significance assessment:

    • Compare activities of modified vs. unmodified protein

    • Evaluate modification dynamics under different conditions

    • Analyze phenotypes of modification site mutants in vivo

For data analysis, implement a robust bioinformatic pipeline including database searching with variable modifications, false discovery rate control, and manual validation of MS/MS spectra for high-confidence modification site assignment .

How should I address contradictory findings during HI_0096 characterization?

When faced with contradictory results during HI_0096 characterization:

  • Systematic troubleshooting protocol:

    • Verify protein identity through mass spectrometry

    • Confirm protein integrity via SDS-PAGE and Western blotting

    • Evaluate experimental conditions for potential artifacts

  • Cross-validation approach:

    • Apply orthogonal methods to verify key findings

    • Document reproducibility across independent protein preparations

    • Implement statistical analysis appropriate for each experimental approach

  • Contextual interpretation:

    • Consider cellular context (e.g., potential binding partners present in vivo but absent in vitro)

    • Evaluate physiological relevance of experimental conditions

    • Compare findings with closely related proteins from other bacterial species

  • Transparent reporting:

    • Document all experimental attempts, including negative results

    • Apply qualitative data analysis techniques including triangulation and peer debriefing

    • Consider member checks where applicable in collaborative research

What bioinformatic pipelines should I use for integrating multi-omics data for HI_0096 functional characterization?

For multi-omics integration:

  • Data types and preprocessing:

    • Genomics: Analyze conservation and genetic context of HI_0096

    • Transcriptomics: Evaluate co-expression patterns under various conditions

    • Proteomics: Map protein abundance, interactions, and modifications

    • Metabolomics: Identify metabolic pathways potentially affected by HI_0096

  • Integration strategies:

    • Network-based approaches using correlation and mutual information

    • Machine learning methods for pattern recognition across datasets

    • Pathway enrichment analysis across multiple data types

  • Visualization and interpretation:

    • Generate integrated network visualizations using tools like Cytoscape

    • Implement dimensionality reduction techniques (PCA, t-SNE) for data exploration

    • Apply clustering algorithms to identify functional modules

  • Validation planning:

    • Design targeted experiments to test hypotheses generated from integrated analysis

    • Prioritize validation experiments based on consistency across data types

    • Implement iterative cycles of prediction and validation

The integration of multiple data types often reveals functional associations not apparent from single-technique approaches, particularly valuable for uncharacterized proteins like HI_0096 .

How can structural information about HI_0096 contribute to vaccine development against H. influenzae?

Structural characterization of HI_0096 can inform vaccine development through:

  • Epitope mapping and analysis:

    • Identify surface-exposed regions using structural models

    • Predict B-cell and T-cell epitopes using immunoinformatic tools

    • Evaluate epitope conservation across H. influenzae strains

  • Structure-based vaccine design:

    • Assess potential for rational antigen design (if HI_0096 is surface-exposed)

    • Evaluate structural stability for formulation considerations

    • Identify potential conformational epitopes from tertiary structure

  • Immunogenicity assessment:

    • Test recombinant HI_0096 for antibody production in animal models

    • Evaluate cross-protection against multiple strains

    • Assess functional antibodies through in vitro assays

For vaccine applications, special attention should be given to protein stability, appropriate adjuvant selection, and demonstration of protective immunity in relevant animal models .

What role might HI_0096 play in H. influenzae pathogenesis and host-pathogen interactions?

To investigate potential roles in pathogenesis:

  • Comparative genomics approach:

    • Analyze HI_0096 conservation across pathogenic and non-pathogenic strains

    • Evaluate genetic context for association with virulence factors

    • Identify potential horizontal gene transfer events

  • Expression analysis during infection:

    • Measure HI_0096 expression in various infection models

    • Compare expression between colonization and invasive disease

    • Evaluate regulation under host-mimicking conditions

  • Interaction with host components:

    • Screen for binding to host extracellular matrix proteins

    • Assess interactions with host immune components

    • Evaluate impact on host cell signaling pathways

  • Mutant phenotype characterization:

    • Analyze HI_0096 knockout strains in colonization and infection models

    • Evaluate contribution to biofilm formation

    • Assess impact on antibiotic resistance and stress responses

If initial evidence suggests a role in pathogenesis, follow up with detailed mechanism studies focusing on specific host-pathogen interaction pathways .

What is the recommended workflow for comprehensive characterization of uncharacterized proteins like HI_0096?

Based on current best practices, a comprehensive characterization workflow should include:

  • Sequential multi-technique approach:

    • Begin with computational predictions (sequence analysis, structural modeling)

    • Proceed to recombinant protein production and basic biochemical characterization

    • Conduct targeted functional assays based on computational predictions

    • Implement systems biology approaches for contextual understanding

  • Iterative validation strategy:

    • Generate multiple lines of evidence for each functional hypothesis

    • Implement both in vitro and in vivo validation approaches

    • Apply both forward and reverse genetics approaches

    • Document negative results to refine functional hypotheses

  • Collaborative multi-disciplinary approach:

    • Combine expertise in bioinformatics, structural biology, biochemistry, and microbiology

    • Implement standardized data collection and sharing practices

    • Apply consistent metadata annotation for reproducibility

This systematic workflow maximizes the probability of successful functional annotation while minimizing resource investment in non-productive experimental directions .

What emerging technologies show promise for accelerating the characterization of proteins like HI_0096?

Several emerging technologies hold particular promise:

  • Advanced computational approaches:

    • Deep learning methods for improved structure prediction (AlphaFold, RoseTTAFold)

    • AI-driven functional annotation integrating multiple data sources

    • Molecular dynamics simulations for interaction and mechanism prediction

  • High-throughput experimental platforms:

    • Microfluidics-based interaction screening using lab-on-a-chip methods

    • CRISPR-based functional genomics approaches adapted for bacterial systems

    • Automated protein expression and characterization platforms

  • Improved structural biology methods:

    • Cryo-EM advances enabling structure determination of smaller proteins

    • Integrative structural biology combining multiple data sources

    • In-cell structural determination methods

  • Systems-level approaches:

    • Multi-omics integration platforms with improved statistical frameworks

    • Single-cell approaches adapted for bacterial systems

    • Physiologically relevant model systems for functional validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.