Recombinant Haemophilus influenzae Uncharacterized protein HI_0120 (HI_0120)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
HI_0120; Uncharacterized protein HI_0120
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0120
Target Protein Sequence
MADPHIKSPMDFLDYLTVIIYRTGFVIAALAVLTVSWYPDLSLTFILIAATCCASSLHIY LKSFRLLFQFATWIGLLFYINHYPALALGGALLTLGGLCFKEYFCFRVPLLNLQPIFVAC LWFSWVLNNLIALRIFSIISGVLLLVLAIQKWRMPLHFDIGDKTKYQI
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0120

STRING: 71421.HI0120

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the HI_0120 protein and why is it significant in Haemophilus influenzae research?

The HI_0120 protein is an uncharacterized protein in Haemophilus influenzae that may play a significant role in bacterial pathogenesis and respiratory tract infections. Haemophilus influenzae is a common inhabitant of the upper respiratory tract and can cause serious infections of mucosal surfaces, making its proteins important targets for understanding virulence mechanisms . Unlike well-characterized proteins such as bacterial lipoprotein e (P4), HI_0120 remains largely uncharacterized in terms of structure and function, presenting opportunities for novel research insights into bacterial pathophysiology. The significance lies in potentially uncovering new therapeutic targets for treating infections caused by this pathogen.

How can researchers express recombinant HI_0120 protein for laboratory studies?

Researchers can express recombinant HI_0120 protein using recombinant DNA technology that replaces the N-terminal signal sequence with one for protein secretion and places expression under the control of an inducible promoter system such as T7. Similar to other Haemophilus influenzae proteins, the process typically involves cloning the HI_0120 gene into an expression vector, transforming it into a suitable bacterial host (commonly E. coli), and inducing expression with IPTG or similar inducers . Purification can then be achieved through chromatography techniques, typically requiring at least two chromatography steps to reach apparent homogeneity. This approach allows researchers to obtain sufficient quantities of the protein for subsequent structural and functional studies without the complications of native lipid modifications that might hinder purification.

What are the common challenges in purifying recombinant HI_0120 protein?

The common challenges in purifying recombinant HI_0120 protein include potential N-terminal lipid modifications that can impede extraction and purification processes. As observed with other Haemophilus influenzae proteins, native lipid modifications can prevent purification of large amounts of protein . Additionally, researchers may encounter issues with protein solubility, proper folding, and retention of biological activity during the purification process. Overcoming these challenges typically requires strategic modification of the expression system, such as replacing the N-terminal lipid modification signal sequence with one for protein secretion without such modification, allowing easier extraction from bacterial membranes. Optimization of chromatography conditions is also essential to achieve high purity while maintaining the protein's structural integrity and functional properties.

What analytical techniques are most effective for confirming the identity of purified HI_0120?

The most effective analytical techniques for confirming the identity of purified HI_0120 include SDS-PAGE for molecular weight determination, mass spectrometry for precise mass analysis, and immunoblotting with specific antibodies when available. Similar to the characterization of other Haemophilus influenzae proteins, researchers should employ physicochemical characterization to confirm primary structure, substrate specificity (if applicable), and sensitivity to various inhibitors . N-terminal sequencing can verify the correct processing of the signal sequence, while circular dichroism spectroscopy helps assess secondary structure elements. For complete validation, comparing the recombinant protein characteristics with those of the native protein isolated from Haemophilus influenzae (when possible) provides the most comprehensive confirmation of proper identity and folding.

How does the secondary structure of HI_0120 compare to other uncharacterized proteins in Haemophilus influenzae?

The secondary structure of HI_0120 likely contains distinct patterns of α-helices and β-sheets that differentiate it from other uncharacterized proteins in Haemophilus influenzae, though comprehensive comparative analyses remain incomplete. Researchers investigating this question should employ a combination of circular dichroism spectroscopy, X-ray crystallography, and computational prediction methods to elucidate the structural elements. Similar to studies on bacterial lipoprotein e (P4), structural characterization should include analysis of pH optimum effects on protein conformation and stability . The methodological approach should incorporate comparative bioinformatics analysis with homologous proteins from related bacterial species to identify conserved structural motifs that might indicate functional significance. This structural information provides crucial insights for understanding potential protein-protein interactions and enzymatic functions that contribute to bacterial pathogenesis.

What experimental approaches can resolve contradictory data about HI_0120's enzymatic activity?

Experimental approaches to resolve contradictory data about HI_0120's enzymatic activity should begin with standardized activity assays under varying conditions of pH, temperature, and substrate concentrations. When faced with conflicting results, researchers should employ multiple complementary techniques including spectrophotometric assays, isothermal titration calorimetry, and enzyme kinetics studies to generate comprehensive activity profiles. Similar to approaches used with other Haemophilus proteins, site-directed mutagenesis of predicted catalytic residues can confirm the enzyme's mechanism of action and resolve discrepancies . Researchers should also consider the influence of potential cofactors, inhibitors, and protein modifications on activity measurements. Advanced approaches such as hydrogen-deuterium exchange mass spectrometry can provide insights into structural dynamics during substrate binding. Standardizing experimental protocols across laboratories and using reference standards for activity measurements can significantly reduce data contradictions and improve reproducibility.

How can researchers effectively study protein-protein interactions involving HI_0120 in native conditions?

Researchers can effectively study protein-protein interactions involving HI_0120 in native conditions through a multi-faceted approach combining in vivo crosslinking, co-immunoprecipitation, and proximity-based labeling techniques. For native membrane interactions, similar to studies with bacterial lipoprotein e (P4), researchers should consider the impact of lipid modifications on protein-protein interactions . Advanced techniques such as biolayer interferometry, surface plasmon resonance, and microscale thermophoresis provide quantitative measurements of binding affinities under near-native conditions. For comprehensive interaction mapping, proximity-dependent biotin identification (BioID) or APEX-based proximity labeling in genetically modified Haemophilus influenzae strains can capture transient and stable interactions in the native bacterial environment. Verification of identified interactions should include reverse co-immunoprecipitation and functional validation through gene knockout/complementation studies to establish biological relevance beyond simple binding.

What is the relationship between HI_0120 expression levels and virulence in different Haemophilus influenzae strains?

The relationship between HI_0120 expression levels and virulence in different Haemophilus influenzae strains requires quantitative analysis across multiple clinical and laboratory isolates using RT-qPCR and immunoblotting techniques. Researchers investigating this relationship should create an isogenic mutant library with HI_0120 expression under varying promoter strengths to directly correlate expression levels with virulence phenotypes. Similar to studies of other Haemophilus proteins, virulence assessment should include adhesion to respiratory epithelial cells, biofilm formation capacity, and survival in human serum . Animal infection models using mice or chinchillas with varying levels of HI_0120 expression can establish direct causality between expression and pathogenicity. RNA-seq analysis comparing transcriptomes of low and high HI_0120-expressing strains can reveal co-regulated virulence factors and provide insights into regulatory networks controlling pathogenesis. This comprehensive approach helps resolve contradictory findings that might arise from strain-specific genetic backgrounds.

What is the optimal expression system for producing high yields of soluble HI_0120 protein?

The optimal expression system for producing high yields of soluble HI_0120 protein is an E. coli BL21(DE3) strain with a T7 promoter-controlled expression vector containing a modified HI_0120 sequence. Similar to successful systems for other Haemophilus influenzae proteins, the modification should replace the native N-terminal lipid modification signal sequence with a secretion signal that facilitates protein export without lipid attachment . Expression should be induced with IPTG at concentrations between 0.1-0.5 mM when cultures reach mid-log phase (OD600 of 0.6-0.8) and continued at lower temperatures (16-20°C) for 16-18 hours to enhance proper protein folding. The addition of solubility-enhancing fusion tags such as MBP (maltose-binding protein) or SUMO can significantly improve yield and solubility. For difficult-to-express constructs, specialized E. coli strains like Rosetta(DE3) that supply rare tRNAs or SHuffle strains that facilitate disulfide bond formation in the cytoplasm may further optimize expression conditions.

What chromatography methods are most effective for purifying HI_0120 to homogeneity?

The most effective chromatography methods for purifying HI_0120 to homogeneity involve a sequential approach starting with affinity chromatography followed by ion exchange and gel filtration techniques. For recombinant HI_0120 with an affinity tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices provides efficient initial capture . This should be followed by anion exchange chromatography using a gradient of 0-500 mM NaCl to separate the target protein from contaminants with different charge properties. Size exclusion chromatography as a final polishing step not only removes aggregates and degradation products but also confirms the quaternary structure of the purified protein. Depending on specific protein characteristics, hydrophobic interaction chromatography may be substituted for ion exchange. Throughout the purification process, buffer conditions (pH 7.0-8.0, 150-300 mM NaCl, 5-10% glycerol) should be optimized to maintain protein stability. This multi-step approach typically achieves >95% purity as assessed by SDS-PAGE and mass spectrometry analysis.

How can researchers develop and validate antibodies specific to HI_0120 for immunological studies?

Researchers can develop and validate antibodies specific to HI_0120 through a systematic process beginning with antigen preparation using highly purified recombinant protein or synthesized peptides representing unique epitopes. For polyclonal antibodies, immunization protocols should include at least three booster injections in rabbits or similar model organisms with adjuvants appropriate for research-grade antibodies. Monoclonal antibody development requires B-cell hybridoma technology with extensive screening to identify clones producing high-affinity, specific antibodies. Validation must include ELISA testing against the immunizing antigen, Western blotting against recombinant protein and Haemophilus influenzae lysates, and immunoprecipitation assays . Cross-reactivity testing against related proteins and lysates from HI_0120 knockout strains provides critical negative controls. Epitope mapping using peptide arrays or hydrogen-deuterium exchange mass spectrometry helps characterize the binding sites and potential interference with protein function. For immunohistochemistry applications, additional validation in fixed bacterial samples and infected tissue specimens confirms specificity in complex biological matrices.

What are the key considerations for designing site-directed mutagenesis experiments with HI_0120?

The key considerations for designing site-directed mutagenesis experiments with HI_0120 include comprehensive sequence analysis to identify evolutionarily conserved residues and predicted functional domains. Researchers should prioritize mutations of amino acids in potential catalytic sites, substrate-binding regions, and protein-protein interaction interfaces based on bioinformatic predictions and structural homology modeling. Similar to approaches with other bacterial proteins, alanine-scanning mutagenesis of conserved motifs can systematically identify functionally critical residues . When designing primers for mutagenesis, researchers should verify minimal unintended secondary structure formation, appropriate melting temperatures (55-65°C), and inclusion of silent mutations that create diagnostic restriction sites for screening. Each mutant construct must be fully sequenced to confirm the intended mutation and absence of unwanted modifications. Experimental validation should include comparative analysis of expression levels, solubility, structural integrity (by circular dichroism), and functional assays. Creating multiple types of substitutions at critical positions (conservative vs. non-conservative) provides deeper insights into the structural requirements for specific functions.

How should researchers interpret contradictory findings from in vitro versus in vivo studies of HI_0120 function?

Researchers should interpret contradictory findings from in vitro versus in vivo studies of HI_0120 function by systematically analyzing the experimental conditions that might account for discrepancies. When faced with contradictions, the first step is to evaluate differences in protein concentration, buffer composition, and the presence of cofactors between in vitro and in vivo environments. Similar to analyses of other bacterial proteins, researchers should consider whether post-translational modifications present only in vivo might affect protein function . The complexity of the in vivo environment means that interaction partners or inhibitors might modulate HI_0120 activity in ways not replicated in simplified in vitro systems. To resolve contradictions, intermediate complexity models such as ex vivo tissue cultures or bacterial co-culture systems can bridge the gap between highly controlled in vitro experiments and complex in vivo conditions. Ultimately, researchers should develop a unified model that explains both sets of observations, possibly by identifying environmental triggers that switch protein function between different operational modes in different contexts.

What statistical approaches are most appropriate for analyzing HI_0120 expression data across different experimental conditions?

The most appropriate statistical approaches for analyzing HI_0120 expression data across different experimental conditions depend on the experimental design and data characteristics. For comparing expression levels between two conditions, t-tests (paired or unpaired) are suitable if data meet normality assumptions, while non-parametric alternatives like Mann-Whitney U or Wilcoxon signed-rank tests should be used for non-normal distributions. For multi-condition experiments, ANOVA followed by appropriate post-hoc tests (Tukey's, Bonferroni, or Dunnett's) enables comprehensive comparison while controlling for multiple testing. Time-course expression data requires repeated measures ANOVA or mixed-effects models to account for temporal correlations. When analyzing correlations between HI_0120 expression and other variables (e.g., virulence factors), Pearson's or Spearman's correlation coefficients provide quantitative relationship measures. For complex datasets with multiple variables, multivariate approaches such as principal component analysis or partial least squares regression can identify patterns and relationships not apparent in univariate analyses. All statistical analyses should include appropriate visualization (box plots, scatter plots with regression lines, heat maps) and reporting of effect sizes alongside p-values to fully communicate biological significance beyond statistical significance.

How can researchers effectively compare structural data for HI_0120 from different biophysical techniques?

Researchers can effectively compare structural data for HI_0120 from different biophysical techniques by establishing a hierarchical integration approach that acknowledges the resolution and limitations of each method. X-ray crystallography and cryo-electron microscopy provide high-resolution atomic structures but represent static snapshots, while nuclear magnetic resonance (NMR) offers medium-resolution data with dynamic information. Similar to approaches used with other bacterial proteins, researchers should first align 3D structures from different methods using root-mean-square deviation (RMSD) calculations to identify regions of consensus and divergence . For comparing secondary structure elements, circular dichroism data can be reconciled with crystallographic or NMR-derived structures using spectral deconvolution algorithms. Small-angle X-ray scattering (SAXS) provides low-resolution envelope data that should be validated against high-resolution structures using computational fitting approaches. When discrepancies occur, researchers should evaluate whether they represent methodological artifacts or biologically relevant conformational states. Molecular dynamics simulations can bridge structural data from different techniques by modeling conformational ensembles that satisfy experimental constraints from multiple methods. This integrated approach produces a more comprehensive understanding of HI_0120 structure than any single technique alone.

What approaches can identify potential moonlighting functions of HI_0120 beyond its primary annotated role?

Approaches to identify potential moonlighting functions of HI_0120 beyond its primary annotated role should combine computational predictions with diverse experimental validation strategies. Computational analysis should include searching for structural similarities with proteins of known function using fold-recognition algorithms, identifying binding motifs for nucleic acids or other ligands, and predicting subcellular localization patterns that might suggest non-canonical roles. Experimentally, similar to approaches with other bacterial proteins, affinity purification followed by mass spectrometry can identify unexpected interaction partners suggesting secondary functions . Phenotypic analysis of HI_0120 knockout strains under diverse stress conditions may reveal growth defects unrelated to the primary function. Metabolomic profiling comparing wild-type and HI_0120-deficient strains can identify unexpected metabolic pathways affected by the protein. Surface plasmon resonance or similar binding assays using diverse biomolecules as potential ligands may uncover unexpected binding capabilities. Transcriptomic analysis of HI_0120 overexpression or deletion strains can reveal affected pathways beyond those connected to the primary function. When potential moonlighting functions are identified, targeted biochemical assays must verify the newly discovered activity in vitro and in vivo to establish biological relevance.

What are the most promising future directions for HI_0120 research in the context of bacterial pathogenesis?

The most promising future directions for HI_0120 research in the context of bacterial pathogenesis include investigating its potential role in host-pathogen interactions and biofilm formation. Given the importance of Haemophilus influenzae in respiratory infections, understanding how HI_0120 contributes to bacterial survival in the respiratory microenvironment represents a critical research avenue . Similar to studies of characterized proteins like bacterial lipoprotein e (P4), researchers should explore whether HI_0120 functions in nutrient acquisition, stress response, or immune evasion during infection. Structural biology approaches should aim to solve the three-dimensional structure, potentially revealing functional sites that could be targeted therapeutically. Systems biology approaches combining transcriptomics, proteomics, and metabolomics data can position HI_0120 within the broader pathogenesis network of Haemophilus influenzae. Developing conditional expression systems and inducible knockouts will enable temporal control of HI_0120 expression during different infection stages, revealing stage-specific functions. As antibiotic resistance in Haemophilus influenzae increases, investigating whether HI_0120 contributes to resistance mechanisms or could serve as a novel therapeutic target represents an especially promising research direction with potential clinical applications.

How can researchers most effectively collaborate across different specialties to fully characterize HI_0120?

Researchers can most effectively collaborate across different specialties to fully characterize HI_0120 by establishing interdisciplinary teams with clear communication structures and shared research objectives. The collaboration should include microbiologists for bacterial culture and genetic manipulation, structural biologists for protein characterization, immunologists for host-pathogen interaction studies, and bioinformaticians for computational analysis and integration of diverse datasets. Similar to successful collaborative studies of other bacterial proteins, establishing standardized protocols for protein preparation and characterization ensures comparability of results across different laboratories . Regular virtual or in-person meetings with structured agendas facilitate information exchange and problem-solving. Collaborative online platforms for sharing protocols, raw data, and analysis tools enhance transparency and reproducibility. Material transfer agreements should be established early to facilitate exchange of bacterial strains, protein samples, antibodies, and other research materials. Publication strategies should be discussed in advance, with authorship guidelines clearly defined to recognize all significant intellectual contributions. Funding applications that specifically support interdisciplinary research can provide resources for collaborative activities such as workshops, visiting scientist programs, and shared equipment. This comprehensive collaborative approach accelerates research progress and produces more robust characterization than any single specialty could achieve independently.

What standardized reporting formats should be adopted for HI_0120 research to enhance reproducibility?

Standardized reporting formats that should be adopted for HI_0120 research to enhance reproducibility must include comprehensive documentation of experimental conditions, reagents, and analytical methods. For protein expression and purification, researchers should report complete plasmid sequences, expression host strains with genotypes, detailed induction conditions (temperature, inducer concentration, duration), and buffer compositions throughout all purification steps . When reporting protein characterization data, all instrument parameters, data processing algorithms, and software versions should be specified. For functional assays, standardized reporting should include positive and negative controls, detailed reaction conditions, and raw data alongside processed results. Statistical analysis reporting must specify the tests used, assumptions verified, sample sizes, and effect sizes with confidence intervals rather than just p-values. Similar to best practices in other fields, researchers should adopt the ARRIVE guidelines for in vivo experiments and appropriate field-specific guidelines for other experiment types. All strains, plasmids, and antibodies should be deposited in public repositories with accession numbers included in publications. Raw data should be shared through appropriate repositories with permanent DOIs. Adoption of these comprehensive reporting standards will significantly enhance the reproducibility and build upon existing research in the field of Haemophilus influenzae proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.