Recombinant Haemophilus influenzae Uncharacterized protein HI_0453 (HI_0453)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if you have a specific requirement. We will fulfill your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_0453; Uncharacterized protein HI_0453
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0453
Target Protein Sequence
MRKFFKYFLFIVVFLFHGFMFSVVNYVFPHYDVTRVTGVEVKRVDKDGPITKSNPADGPT RDVYYINTQNDDGKIMVYRNEDTRWGFPFYFKFGSANLQAEAQALGNDNKLVQIKYYGWR ITMVDEYRNATSIKEITADDTPSNPIVSWILYVFLLATLFLSIQFIRGWFDSDK
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0453

STRING: 71421.HI0453

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HI_0453 and why is it classified as an uncharacterized protein?

HI_0453 is a protein from Haemophilus influenzae that has been identified through genomic sequencing but lacks experimental validation of its function. It belongs to the category of hypothetical proteins (HPs), which are proteins predicted to be expressed from an open reading frame (ORF) but for which there is no experimental evidence of translation or functional characterization . The protein consists of 174 amino acids and has been assigned the UniProt ID P43999 . Despite having a complete amino acid sequence, insufficient experimental data exists to confirm its physiological role, cellular localization, or biochemical properties, hence its "uncharacterized" status.

How is recombinant HI_0453 typically produced for research purposes?

Recombinant HI_0453 protein is typically produced using E. coli expression systems with an N-terminal histidine tag for purification purposes . The production process involves several key steps: (1) Cloning of the HI_0453 gene into an appropriate expression vector containing a His-tag coding sequence; (2) Transformation of the construct into a compatible E. coli strain; (3) Induction of protein expression, commonly using IPTG for T7-based expression systems; (4) Cell lysis to release the expressed protein; (5) Purification via affinity chromatography using the His-tag; and (6) Quality assessment through SDS-PAGE to confirm purity (typically >90%) . The purified protein is often lyophilized for storage and can be reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL for experimental use .

What are the optimal storage conditions for recombinant HI_0453 protein?

For maintaining optimal stability and activity of recombinant HI_0453, the protein should be stored at -20°C to -80°C upon receipt . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) before aliquoting and freezing . The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution processes . Prior to opening, the vial should be briefly centrifuged to ensure all contents are at the bottom.

What bioinformatic approaches can be used to predict the function of HI_0453?

Functional prediction of HI_0453, like other hypothetical proteins, requires multiple complementary bioinformatic approaches. The most comprehensive strategy includes:

  • Homology-based methods: BLAST searches against characterized proteins to identify distant relatives with known functions that may suggest similar roles .

  • Domain and motif analysis: Tools like PFAM, PROSITE, and InterProScan can identify conserved domains and motifs that might indicate function .

  • Structural prediction: Using algorithms like I-TASSER, SWISS-MODEL, or AlphaFold to predict tertiary structure, followed by structural alignment with functionally characterized proteins .

  • Subcellular localization prediction: Tools like PSORT, TargetP, and TMHMM can predict where the protein might function within the cell .

  • Protein-protein interaction prediction: STRING database and similar resources can suggest potential interaction partners, providing functional context .

  • Phylogenetic profiling: Analyzing the presence/absence pattern of HI_0453 across different species can provide clues about its evolutionary conservation and potential functional importance .

  • Genomic context analysis: Examining neighboring genes can suggest involvement in particular pathways or functional clusters .

The integration of these various predictive approaches can significantly narrow down potential functions, though experimental validation remains essential for definitive functional assignment.

How can mass spectrometry be optimized for characterization of HI_0453?

Optimizing mass spectrometry (MS) for HI_0453 characterization requires a multi-step approach:

First, sample preparation should include both in-solution and in-gel digestion protocols using multiple proteases (not just trypsin) to maximize sequence coverage . For HI_0453, which may have membrane-associated domains, specialized detergent-based extraction protocols should be employed before digestion.

For the MS analysis itself, a combination of peptide mass fingerprinting and tandem MS (MS/MS) approaches is recommended . While peptide mass fingerprinting might be sufficient for confirmation of protein identity, MS/MS is essential for post-translational modification (PTM) analysis and detailed structural characterization . Multiple fragmentation techniques should be utilized, including collision-induced dissociation (CID), electron transfer dissociation (ETD), and higher-energy collisional dissociation (HCD), as each can provide complementary information about peptide structure.

Data analysis should employ multiple search algorithms (e.g., MASCOT, SEQUEST, X!Tandem) against comprehensive databases . For HI_0453, which lacks characterized homologs, de novo sequencing approaches may be particularly valuable. Additionally, specialized software for PTM detection should be applied to identify any modifications that might provide functional clues.

Finally, quantitative MS approaches (e.g., SILAC, iTRAQ, or label-free quantification) can be used to monitor HI_0453 expression under different conditions, potentially providing insights into its regulation and function .

What experimental approaches would be most effective for determining the subcellular localization of HI_0453?

Determining the subcellular localization of HI_0453 requires a multi-faceted experimental approach:

  • Fluorescent protein fusion constructs: Creating N- and C-terminal GFP (or other fluorescent protein) fusions with HI_0453 for expression in H. influenzae or model systems, followed by confocal microscopy to visualize localization patterns.

  • Immunofluorescence microscopy: Developing specific antibodies against HI_0453 for immunostaining of fixed cells, with co-localization studies using known organelle markers.

  • Subcellular fractionation: Performing differential centrifugation to separate cellular components (membrane, cytoplasm, periplasm, etc.), followed by Western blot analysis or mass spectrometry to detect HI_0453 in specific fractions .

  • Surface biotinylation: If outer membrane localization is suspected, surface-exposed proteins can be selectively labeled with biotin, purified, and analyzed for the presence of HI_0453.

  • Protease accessibility assays: Limited proteolysis of intact cells versus lysed cells can indicate whether HI_0453 is accessible from the cell surface or protected within the cell.

  • Membrane extraction studies: Sequential extraction with increasingly harsh detergents can help determine the strength of membrane association.

Combining these approaches provides complementary data that can conclusively establish the subcellular localization of HI_0453, which is a critical step toward understanding its function in H. influenzae.

How can protein-protein interaction studies be designed to identify binding partners of HI_0453?

Comprehensive protein-protein interaction studies for HI_0453 should employ multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) screening: Using HI_0453 as bait against a library of H. influenzae proteins can identify direct binary interactions. Both N- and C-terminal fusions should be tested to minimize false negatives due to interference with interaction domains.

  • Pull-down assays with tandem mass spectrometry: Utilizing the His-tagged recombinant HI_0453 for affinity purification of interacting proteins from H. influenzae lysates, followed by MS/MS identification . Crosslinking protocols prior to lysis can stabilize transient interactions.

  • Co-immunoprecipitation (Co-IP): Developing specific antibodies against HI_0453 for immunoprecipitation of the protein along with its interaction partners from native conditions.

  • Proximity-dependent biotin identification (BioID): Fusing HI_0453 to a biotin ligase that biotinylates nearby proteins, allowing for streptavidin-based purification and identification of proximal proteins, including those with transient interactions.

  • Microfluidics protein interaction analysis: Lab-on-a-chip methods can provide rapid, high-throughput screening of potential interactions with controlled conditions and minimal sample consumption .

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): For validating and quantifying specific interactions identified through screening approaches, determining binding kinetics and affinity constants.

  • Bacterial two-hybrid system: As an alternative to Y2H, specially designed for bacterial proteins like HI_0453.

The data from these various approaches should be integrated into an interaction network and validated through multiple methods to minimize false positives and negatives.

What are the essential controls needed when testing for enzymatic activity of HI_0453?

When testing for potential enzymatic activity of the uncharacterized HI_0453 protein, a rigorous set of controls is essential:

  • Negative controls:

    • Heat-denatured HI_0453 to ensure observed activity is due to the native protein structure

    • Buffer-only reactions to rule out contaminating activities in reagents

    • Irrelevant proteins of similar size/preparation to ensure specificity

    • E. coli host-derived protein preparations to exclude host enzyme contamination

  • Positive controls:

    • Known enzymes performing similar reactions to validate assay functionality

    • Graded concentrations of end products to establish detection limits and standard curves

  • Substrate specificity controls:

    • Testing multiple related substrates to establish specificity profiles

    • Competitive inhibition with substrate analogs

  • Reaction condition controls:

    • pH dependency assessment (pH 4-10 range)

    • Temperature optimization experiments (4-70°C)

    • Metal ion dependency tests (with and without EDTA; adding various metal ions)

    • Reducing/oxidizing condition variations

  • Protein quality controls:

    • Fresh vs. stored protein comparisons to assess stability

    • Different concentrations of HI_0453 to confirm dose-dependent activity

    • Multiple protein preparation batches to ensure reproducibility

  • Site-directed mutagenesis controls:

    • If catalytic residues are predicted, testing mutant versions with altered putative active sites

This comprehensive control scheme ensures that any detected activity can be confidently attributed to HI_0453 rather than experimental artifacts or contaminants.

How can microarray analysis be utilized to understand the expression patterns of HI_0453?

Microarray analysis provides valuable insights into the expression patterns of HI_0453 through multiple experimental approaches:

  • Transcriptional profiling across conditions: Designing DNA microarrays containing the HI_0453 gene along with the complete H. influenzae genome allows monitoring expression under various environmental stresses (temperature, pH, nutrient limitation, oxidative stress), growth phases, and host interaction models . Clustering analysis with genes of known function can suggest functional relationships.

  • Comparative transcriptomics: Analyzing HI_0453 expression across multiple H. influenzae strains or related species can reveal whether expression patterns are conserved or strain-specific, providing evolutionary context.

  • Regulatory network mapping: Using chromatin immunoprecipitation (ChIP-chip) approaches with antibodies against various transcription factors can identify potential regulators of HI_0453 expression.

  • Protein microarrays: Developing protein microarrays with purified HI_0453 can screen for interactions with other proteins, DNA, RNA, or small molecules, complementing transcriptomic data with functional interaction information .

  • Reverse phase protein microarrays: These can quantify HI_0453 protein levels across multiple samples simultaneously, bridging transcriptomic data with actual protein abundance.

  • Analytical controls and validation: All microarray findings should be validated using quantitative PCR (for transcriptional data) or Western blotting (for protein data) on select conditions to confirm microarray accuracy.

Data integration from these various microarray approaches can position HI_0453 within specific cellular pathways and processes, substantially narrowing the functional possibilities for this uncharacterized protein .

How should contradictory results between bioinformatic predictions and experimental data for HI_0453 be resolved?

Resolving contradictions between bioinformatic predictions and experimental data for HI_0453 requires a systematic approach:

  • Reassess bioinformatic methodology:

    • Evaluate whether appropriate algorithms were used

    • Check if the prediction confidence scores were high or borderline

    • Try alternative prediction tools and see if they converge on a consistent answer

    • Consider whether the protein might have unusual features that typical algorithms miss

  • Review experimental design and execution:

    • Examine whether appropriate controls were included

    • Assess whether the recombinant protein maintained its native structure

    • Consider if the experimental conditions were physiologically relevant

    • Evaluate technical reproducibility across replicates

  • Contextual integration:

    • Consider the evolutionary context - do orthologous proteins in related species show similar contradictions?

    • Examine the genomic neighborhood of HI_0453 for functional clues

    • Consider whether HI_0453 might be multifunctional or have context-dependent functions

  • Follow-up experiments:

    • Design targeted experiments that specifically address the contradiction

    • Use orthogonal methods to test the same property or function

    • Consider whether post-translational modifications might explain differences

  • Data integration approach:

    • Develop a weighted confidence model that integrates multiple predictions and experimental results

    • Consider Bayesian approaches that can incorporate prior probabilities and update with new evidence

  • Collaborative validation:

    • Engage specialists in both computational and experimental approaches

    • Consider independent laboratory validation of critical findings

This methodical approach acknowledges that both computational predictions and experimental results can have limitations, and that a more complete understanding often emerges through their careful integration and critical evaluation.

How can structural models of HI_0453 be validated experimentally?

Experimental validation of structural models for HI_0453 involves multiple complementary approaches:

This multi-method validation approach provides complementary structural information at different levels of resolution, creating a comprehensive assessment of model accuracy.

What approaches can differentiate whether HI_0453 functions as a monomer or oligomer?

Determining the oligomeric state of HI_0453 requires multiple complementary biophysical and biochemical approaches:

  • Size Exclusion Chromatography (SEC):

    • Running purified HI_0453 through calibrated columns to estimate molecular weight

    • Comparing elution profiles with known monomeric and oligomeric standards

    • Testing multiple protein concentrations to detect concentration-dependent oligomerization

  • Multi-Angle Light Scattering (MALS):

    • Coupling SEC with MALS for absolute molecular weight determination

    • Calculating the mass distribution across the elution profile

    • Determining whether multiple species exist in solution

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments to determine the sedimentation coefficient

    • Sedimentation equilibrium studies to directly measure molecular weight

    • Analyzing concentration-dependent behavior across multiple speeds

  • Native PAGE:

    • Comparing migration patterns with known molecular weight standards

    • Using gradient gels to enhance resolution

    • Chemical crosslinking prior to analysis to stabilize transient interactions

  • Chemical Crosslinking Mass Spectrometry (XL-MS):

    • Using bifunctional crosslinkers followed by MS analysis

    • Identifying intermolecular crosslinks that indicate oligomerization

    • Mapping interaction interfaces between subunits

  • Microscale Thermophoresis (MST) or Isothermal Titration Calorimetry (ITC):

    • Measuring self-association by titrating labeled protein with unlabeled protein

    • Determining binding constants for self-association

    • Characterizing thermodynamic parameters of oligomerization

  • Single-Molecule Techniques:

    • Fluorescence correlation spectroscopy to measure diffusion coefficients

    • Single-molecule FRET to detect conformational changes associated with oligomerization

    • Total internal reflection fluorescence microscopy to visualize individual molecules/complexes

  • Structural Methods:

    • Cryo-electron microscopy for direct visualization of oligomeric assemblies

    • X-ray crystallography to determine high-resolution oligomeric structures

    • Small-angle X-ray scattering to assess shape and dimensions in solution

Integration of data from these complementary approaches provides robust characterization of the oligomeric state of HI_0453 under various conditions.

How might HI_0453 be utilized in recombinant vaccine development approaches?

The potential application of HI_0453 in recombinant vaccine development presents several promising research directions:

  • Antigenic determinant characterization:

    • Epitope mapping using overlapping peptide arrays to identify immunogenic regions

    • B-cell and T-cell epitope prediction algorithms followed by experimental validation

    • Assessment of cross-reactivity with proteins from other bacterial species

  • Immunogen design strategies:

    • Fusion of HI_0453 (or its immunogenic epitopes) with virus-like particles as carriers

    • Development of DNA vaccines encoding HI_0453 for delivery to immune cells

    • Design of multi-epitope constructs combining HI_0453 epitopes with those from other H. influenzae antigens

  • Expression system optimization:

    • Comparison of bacterial, yeast, insect, and mammalian expression systems for optimal antigen presentation

    • Development of codon-optimized constructs for various expression platforms

    • Purification protocols that maintain critical conformational epitopes

  • Delivery platform development:

    • Encapsulation in nanoparticles for targeted delivery to antigen-presenting cells

    • Formulation with various adjuvants to enhance immunogenicity

    • Development of mucosal delivery systems for respiratory tract immunization

  • Immune response characterization:

    • Assessment of antibody titers, specificity, and functional activity

    • Evaluation of cellular immune responses (CD4+ and CD8+ T cells)

    • Determination of memory response durability

  • Protective efficacy studies:

    • Challenge studies in appropriate animal models

    • Evaluation of bacterial clearance, colonization reduction, and disease prevention

    • Assessment of cross-protection against different H. influenzae strains

  • Combination approaches:

    • Evaluation of HI_0453 in multi-antigen formulations

    • Assessment of synergistic effects with other vaccine components

    • Development of prime-boost strategies combining protein and DNA vaccination

This research framework would systematically evaluate the potential of HI_0453 as a vaccine component, potentially contributing to improved prevention strategies against H. influenzae infections.

What CRISPR-based approaches could be used to study the function of HI_0453 in H. influenzae?

CRISPR-based approaches offer powerful tools for elucidating the function of HI_0453 in H. influenzae:

  • Gene knockout studies:

    • Development of CRISPR-Cas9 systems optimized for H. influenzae

    • Design of guide RNAs targeting multiple sites within the HI_0453 gene

    • Creation of markerless knockout strains through homology-directed repair

    • Comprehensive phenotypic characterization across various growth conditions

  • CRISPRi for conditional knockdown:

    • Implementing catalytically inactive Cas9 (dCas9) systems for transcriptional repression

    • Creating inducible CRISPRi constructs to control the timing of HI_0453 repression

    • Titrating expression levels to identify threshold requirements

    • Time-course studies to differentiate primary from secondary effects

  • CRISPRa for overexpression studies:

    • Adapting CRISPR activation systems for H. influenzae

    • Upregulating HI_0453 expression to identify gain-of-function phenotypes

    • Examining effects on bacterial pathogenicity and stress responses

  • Base and prime editing:

    • Using CRISPR base editors to introduce point mutations without double-strand breaks

    • Creating specific amino acid substitutions to test structure-function hypotheses

    • Targeting predicted active sites or protein interaction domains

  • Epitope tagging via CRISPR:

    • HDR-mediated insertion of epitope tags for tracking protein localization

    • Integration of fluorescent protein fusions for live-cell imaging

    • Insertion of affinity tags for purification of native protein complexes

  • CRISPR interference with neighboring genes:

    • Systematic perturbation of genes in the same operon or genomic neighborhood

    • Identifying functional relationships through genetic interaction mapping

    • Constructing pathway models based on shared phenotypes

  • CRISPR screens in infection models:

    • Developing pooled CRISPR libraries in H. influenzae

    • Screening for HI_0453-dependent colonization or virulence phenotypes

    • Identifying host factors that interact with HI_0453 through host cell CRISPR screens

These approaches would systematically dissect the function of HI_0453 within its native context, providing insights that are difficult to obtain through in vitro studies of the purified protein alone.

How can metabolomic approaches contribute to understanding the function of HI_0453?

Metabolomic approaches can provide unique insights into the function of uncharacterized proteins like HI_0453 by revealing their impact on cellular metabolism:

  • Comparative metabolomics of wildtype vs. HI_0453 mutants:

    • Untargeted metabolite profiling using LC-MS/MS and GC-MS

    • Identifying metabolites with significantly altered concentrations

    • Pathway enrichment analysis to identify affected metabolic networks

    • Time-course studies during different growth phases

  • Stable isotope labeling experiments:

    • Feeding HI_0453 knockout and wildtype strains with 13C-labeled carbon sources

    • Tracing isotope incorporation into various metabolic intermediates

    • Identifying alterations in metabolic flux through specific pathways

    • Combining with computational flux balance analysis for pathway modeling

  • Metabolite-protein interaction studies:

    • Metabolite affinity purification with immobilized HI_0453

    • Thermal shift assays to identify metabolites that bind and stabilize HI_0453

    • Isothermal titration calorimetry to quantify binding affinities

    • Activity-based protein profiling to identify functional interactions

  • Targeted metabolomics for hypothesis testing:

    • Based on initial findings, developing targeted assays for specific metabolite classes

    • Quantitative analysis of concentration changes with high precision

    • Examining dynamic responses to environmental perturbations

    • Correlating with transcriptomic and proteomic changes

  • In vitro reconstitution experiments:

    • Testing whether purified HI_0453 can directly catalyze reactions suggested by metabolomic data

    • Identifying cofactor requirements through supplementation experiments

    • Examining substrate specificity across related metabolites

  • Metabolomic imaging:

    • Mass spectrometry imaging to localize metabolite changes within bacterial colonies

    • Correlating with HI_0453 localization data to identify spatial relationships

  • In-host metabolomics:

    • Examining metabolite profiles during infection with wildtype vs. HI_0453 mutants

    • Identifying host-pathogen metabolic interactions that depend on HI_0453

    • Correlating with virulence phenotypes

This comprehensive metabolomic approach would provide functional insights based on the actual biochemical consequences of HI_0453 activity in living cells, potentially revealing roles in metabolic regulation, stress response, or host interaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.