Recombinant Haemophilus influenzae Uncharacterized protein HI_0489 (HI_0489)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant HI_0489 protein is produced under the following conditions :

ParameterDetail
Expression HostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS-based buffer (6% Trehalose, pH 8.0)
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)
ReconstitutionSterile water (0.1–1.0 mg/mL), with optional 5–50% glycerol for stability

Functional and Interaction Insights

While HI_0489 is classified as a "conserved hypothetical protein," bioinformatics analyses suggest potential roles in microbial pathways. Key findings include:

  • Interaction Partners: HI_0489 shows genetic co-occurrence with proteins involved in dimethyl sulfoxide (DMSO) metabolism, including DmsABC (anaerobic DMSO reductase subunits) and MerT/P (mercury transport proteins) .

  • Pathway Association: Though no specific pathways are confirmed, computational tools link it to redox-related processes due to its interaction with DmsABC .

Research Applications

HI_0489 is primarily used in:

  1. Structural Studies: Its high purity and solubility make it suitable for crystallography or NMR.

  2. Antigen Development: As a conserved protein, it may serve as a vaccine candidate against H. influenzae infections.

  3. Functional Annotation: Efforts to resolve its role in H. influenzae biology are ongoing, particularly in multi-drug-resistant strains .

Challenges and Future Directions

The lack of functional annotation remains a barrier. Key research gaps include:

  • Mechanistic Role: Does HI_0489 contribute to virulence, metabolism, or antibiotic resistance?

  • Structural Insights: 3D structure determination could reveal binding sites or enzymatic activity.

  • Clinical Relevance: Its presence in pan-resistant H. influenzae lineages warrants investigation into its role in pathogenicity .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling specific format requests. Please indicate your desired format in your order notes, and we will accommodate your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timelines.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a typical shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the solution for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your requested tag.
Synonyms
HI_0489; Uncharacterized protein HI_0489
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0489
Target Protein Sequence
MDIFSFFSADFWQANSLCFMFISAFLSATVLPGNSEVIFVALAVPKLMLGSLFNVDILAL ILIATAGNSLGSLTTYGIGRWMPKFDPKNYRTLWAINQLRRYGAIALLLSWLPVVGDLFC AIAGWLRLNFVTSSLFIFLGKMVRYVALLFLSTPFLL
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0489

STRING: 71421.HI0489

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Uncharacterized Protein HI_0489 and what are its basic properties?

HI_0489 is an uncharacterized protein from Haemophilus influenzae, a major opportunistic human pathogen that causes both non-invasive and invasive disease. The full-length protein consists of 157 amino acids and has the UniProt ID P44005. Based on its amino acid sequence, which contains multiple hydrophobic regions, it likely functions as a membrane-associated protein .

Key physical properties of recombinant HI_0489 include:

PropertySpecification
Protein LengthFull Length (1-157 amino acids)
UniProt IDP44005
Molecular FormLyophilized powder
Purity>90% (as determined by SDS-PAGE)
Expression SystemE. coli with N-terminal His tag
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

The hydrophobic nature of its amino acid sequence suggests possible roles in membrane transport, signaling, or structural functions, though experimental validation is required to confirm its precise biological role .

What are the optimal storage and handling conditions for recombinant HI_0489?

For optimal stability and activity of recombinant HI_0489, researchers should adhere to the following storage and handling protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles, which significantly degrade protein quality

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Use deionized sterile water to reconstitute to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (typically 50%) as a cryoprotectant

The reconstituted protein with glycerol should be stored at -20°C/-80°C for long-term storage. Repeated freeze-thaw cycles significantly reduce protein stability and activity and should be strictly avoided .

What are the recommended approaches for using HI_0489 in structural biology studies?

When designing structural biology experiments for membrane proteins like HI_0489, researchers should consider the following methodological approaches:

  • Sample Preparation:

    • Optimize expression in specialized E. coli strains designed for membrane proteins

    • Screen multiple detergents for solubilization (DDM, LMNG, OG)

    • Consider amphipols or nanodiscs for stabilization in a membrane-like environment

  • Structural Determination Techniques:

    • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins

    • X-ray crystallography: Using lipidic cubic phase or bicelle crystallization methods

    • Solution NMR: For dynamic studies of specific domains or interactions

  • Computational Modeling:

    • Homology modeling: Using structurally similar proteins as templates

    • Molecular dynamics simulations: To study membrane interactions and conformational changes

    • Ab initio modeling: For regions lacking structural homologs

Given HI_0489's sequence characteristics suggesting multiple transmembrane regions, researchers should be prepared for challenges in expression and purification typical of membrane proteins, including potential toxicity to expression hosts and difficulty maintaining native conformation during purification .

How can researchers validate predicted functions for HI_0489 and other uncharacterized proteins?

Validating functions of uncharacterized proteins like HI_0489 requires a systematic approach combining computational predictions with experimental validation:

  • Computational Function Prediction:

    • Sequence-based analysis using multiple prediction algorithms

    • Structural modeling and binding site prediction

    • Genomic context analysis (neighboring genes often have related functions)

    • Performance evaluation using ROC analysis to assess prediction reliability

  • Experimental Validation Methods:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Protein-protein interaction studies to identify binding partners

    • Complementation assays to confirm predicted function

    • Biochemical assays targeted to specific predicted functions

  • Evaluation Protocol:

    • Use a standardized validation pipeline similar to those used for other H. influenzae proteins

    • Implement ROC analysis to evaluate prediction accuracy (previous studies on H. influenzae proteins achieved accuracy of 96.25%)

    • Compare with functionally characterized proteins from the same organism as reference standards

For membrane proteins like HI_0489, additional specialized approaches such as transport assays, electrophysiology studies, or lipid interaction analyses may be required based on specific functional predictions .

What experimental controls should be included when working with recombinant HI_0489 in molecular biology experiments?

When designing experiments with recombinant HI_0489, the following controls should be systematically incorporated:

  • Expression and Purification Controls:

    • Empty vector control (expression host with expression vector lacking HI_0489 gene)

    • Non-induced control (expression host containing HI_0489 construct without inducer)

    • His-tagged control protein (known protein with similar size/properties as HI_0489)

  • Activity Assay Controls:

    • Heat-denatured HI_0489 (negative control)

    • Commercially available related proteins with known function (positive control)

    • Buffer-only control (to identify buffer-specific effects)

  • Interaction Study Controls:

    • Non-specific binding control (e.g., using unrelated His-tagged protein)

    • Competition assays with unlabeled protein

    • Reverse pull-down experiments with suspected binding partners

  • Localization Study Controls:

    • Known membrane protein control (for membrane localization studies)

    • Known cytoplasmic protein control

    • Secondary antibody-only control (for immunofluorescence)

  • Specificity Controls:

    • Protein from closely related bacterial species

    • Mutated versions of HI_0489 with altered key residues

These controls help distinguish true biological activities from artifacts and ensure experimental rigor when working with this uncharacterized protein .

How does research on HI_0489 contribute to our understanding of Haemophilus influenzae pathogenesis?

Research on uncharacterized proteins like HI_0489 provides critical insights into H. influenzae pathogenesis through several mechanisms:

  • Potential Virulence Contributions:

    • Membrane proteins like HI_0489 often mediate host-pathogen interactions

    • They may contribute to adhesion, invasion, or immune evasion

    • Their study can reveal novel virulence mechanisms distinct from known pathways

  • Contextualizing Population Genetics:

    • Recent research has shown H. influenzae has a highly admixed population structure with evidence of pervasive negative selection

    • No specific lineages were found to be enriched in disease samples, suggesting invasive capability is widespread

    • Understanding proteins like HI_0489 helps explain how different strains maintain pathogenic potential

  • Antibiotic Resistance Mechanisms:

    • With increasing multi-drug resistance (MDR) in H. influenzae globally, membrane proteins may contribute to resistance

    • If HI_0489 functions in transport, it could potentially be involved in drug efflux

    • Characterizing such proteins helps identify novel targets for antimicrobial development

  • Non-typeable H. influenzae Biology:

    • While H. influenzae type b (Hib) vaccines are available, they don't protect against non-typeable strains

    • Recent studies show 91.7% of isolates were non-typeable in certain populations

    • Understanding conserved proteins like HI_0489 across strains could inform broader prevention strategies

Investigating HI_0489 contributes to filling critical knowledge gaps in H. influenzae pathogenesis, particularly as this organism represents an urgent concern due to increasing antibiotic resistance .

What comparative genomics approaches would be most valuable for understanding HI_0489's evolutionary significance?

To understand the evolutionary significance of HI_0489, researchers should implement the following comparative genomics approaches:

  • Ortholog Identification and Analysis:

    • Identify HI_0489 orthologs across different strains of H. influenzae and related species

    • Calculate sequence conservation metrics to identify evolutionarily constrained regions

    • Analyze selection pressures (dN/dS ratios) to identify regions under purifying or positive selection

  • Genomic Context Analysis:

    • Examine gene neighborhood conservation (synteny)

    • Identify co-evolution patterns with functionally related genes

    • Analyze operon structures across species

  • Phylogenetic Profiling:

    • Create presence/absence patterns across bacterial species

    • Correlate with specific phenotypes or ecological niches

    • Identify co-evolving gene sets suggesting functional relationships

  • Structural Homology Mapping:

    • Map sequence conservation onto predicted structural models

    • Identify structurally conserved regions likely to be functionally important

    • Compare with structurally characterized proteins from other species

  • Population Genomics Integration:

    • Analyze HI_0489 variants across clinical isolates

    • Correlate specific variants with virulence or antibiotic resistance

    • Compare variation patterns with the broader genomic context

This multi-faceted approach would place HI_0489 within the evolutionary context of H. influenzae's "highly admixed population structure" and "low core genome nucleotide diversity" reported in recent comprehensive studies .

How might HI_0489 contribute to antibiotic resistance mechanisms in Haemophilus influenzae?

While the exact function of HI_0489 remains uncharacterized, its properties as a predicted membrane protein suggest several potential roles in antibiotic resistance:

  • Direct Resistance Mechanisms:

    • Drug efflux: As a membrane protein, HI_0489 could function as part of efflux pump systems that expel antibiotics

    • Membrane permeability: It might alter membrane composition or structure to reduce antibiotic penetration

    • Target modification: It could interact with and modify antibiotic targets in the cell envelope

  • Indirect Resistance Contributions:

    • Stress response: May participate in membrane-associated stress responses that enhance survival during antibiotic exposure

    • Biofilm formation: Could contribute to biofilm development, providing physical protection from antibiotics

    • Metabolic adaptation: Might facilitate metabolic shifts that reduce susceptibility to specific antibiotics

  • Experimental Approaches to Investigate:

    • Expression analysis: Compare HI_0489 expression levels between resistant and susceptible strains

    • Gene knockout studies: Assess changes in antibiotic susceptibility in HI_0489 deletion mutants

    • Protein interaction studies: Identify interactions with known resistance determinants

This research direction is particularly important given recent findings that H. influenzae has developed "nearly pan-resistant lineages" and that "MDR lineages are not confined to our newly-sequenced dataset, and their establishment globally is an urgent concern" .

What systems biology approaches can advance our understanding of HI_0489's role in bacterial physiology?

Systems biology offers powerful frameworks to contextualize HI_0489 within the broader physiology of H. influenzae:

  • Multi-omics Integration Strategies:

    • Transcriptomics: Analyze HI_0489 expression patterns under different conditions

    • Proteomics: Identify post-translational modifications and interaction partners

    • Metabolomics: Detect metabolic changes in HI_0489 mutants

    • Integration techniques: Network analysis combining multiple data types

  • Network Analysis Approaches:

    • Protein-protein interaction networks: Place HI_0489 within the interactome

    • Gene co-expression networks: Identify functionally related genes

    • Metabolic networks: Model effects of HI_0489 on metabolic pathways

    • Regulatory networks: Understand HI_0489 regulation and its regulatory effects

  • Genome-scale Modeling Methods:

    • Constraint-based models: Integrate HI_0489 into genome-scale metabolic models

    • Dynamic modeling: Simulate temporal effects of HI_0489 activity

    • Host-pathogen interaction modeling: Simulate effects on infection dynamics

  • Recommended Experimental Design:

    • Perturbation experiments: Systematically alter conditions to observe HI_0489 responses

    • Time-course studies: Capture dynamic responses during infection or stress

    • Multi-strain comparisons: Compare systems-level effects across clinical isolates

This systems approach is particularly valuable given recent findings about H. influenzae population structure and the need to understand how proteins like HI_0489 contribute to the organism's adaptability and pathogenic potential across diverse strains .

How can structural biology techniques be optimized for studying membrane proteins like HI_0489?

Membrane proteins like HI_0489 present unique challenges for structural biology studies that require specialized approaches:

  • Sample Preparation Optimization:

    • Expression system selection: Use specialized systems for membrane proteins (C41/C43 E. coli strains, insect cells)

    • Detergent screening protocol:

      • Start with a panel of mild detergents (DDM, LMNG, GDN)

      • Assess protein stability using thermal shift assays

      • Optimize detergent concentration around CMC

    • Alternative membrane mimetics:

      • Nanodiscs for native-like lipid environment

      • Amphipols for enhanced stability

      • Lipidic cubic phase for crystallization

  • Structural Determination Methods:

    • Cryo-EM workflow:

      • Single particle analysis for larger complexes

      • Optimize grid preparation to prevent preferential orientation

      • Consider antibody fragments to increase particle size

    • X-ray crystallography adaptations:

      • Lipidic cubic phase crystallization

      • In meso crystallization methods

      • Surface entropy reduction

  • Integrative Structural Biology Approach:

    • Combine low and high-resolution methods:

      • Small-angle X-ray scattering for solution conformation

      • Hydrogen-deuterium exchange mass spectrometry for dynamics

      • Cross-linking mass spectrometry for interaction mapping

    • Computational methods integration:

      • Molecular dynamics simulations in membrane environment

      • Enhanced sampling techniques for conformational exploration

      • Integrative modeling combining experimental constraints

This optimized approach accounts for HI_0489's predicted membrane localization based on its hydrophobic amino acid sequence and provides the best chance for successful structural characterization .

What methods can be used to identify potential interaction partners and functional networks involving HI_0489?

Identifying interaction partners and functional networks for HI_0489 requires specialized approaches for membrane proteins:

  • Protein-Protein Interaction Identification:

    • Membrane-specific yeast two-hybrid systems

    • Split-ubiquitin assays optimized for membrane proteins

    • Proximity labeling approaches (BioID, APEX) in bacterial systems

    • Co-immunoprecipitation with membrane-compatible detergents

    • Crosslinking mass spectrometry with membrane-permeable crosslinkers

  • Genetic Interaction Mapping:

    • Synthetic genetic arrays with HI_0489 deletion/depletion

    • CRISPRi/CRISPRa screens to identify genetic interactions

    • Suppressor mutation screening to identify functional relationships

    • Transposon mutagenesis combined with HI_0489 perturbation

  • Functional Network Analysis:

    • Co-expression network analysis across diverse conditions

    • Metabolic flux analysis in wild-type vs. HI_0489 mutants

    • Phenotypic profiling under different stresses

    • Comparative analysis with known membrane protein networks

  • Data Integration Framework:

    • Bayesian network integration of multiple data sources

    • Machine learning approaches to predict functional associations

    • Visualization tools optimized for membrane protein networks

    • Context-specific network modeling (e.g., during infection)

  • Validation Strategies:

    • Reciprocal pull-down experiments

    • Mutational analysis of interaction interfaces

    • In vivo co-localization studies

    • Functional assays of predicted protein complexes

This multi-faceted approach would provide comprehensive insights into HI_0489's functional context within H. influenzae and potentially reveal its role in pathogenesis or antibiotic resistance .

How could understanding HI_0489 contribute to novel antimicrobial development strategies?

Understanding HI_0489 could significantly impact antimicrobial development through several mechanisms:

  • Novel Target Evaluation:

    • Target validation criteria:

      • Essentiality assessment through gene deletion studies

      • Conservation analysis across H. influenzae strains

      • Absence of human homologs to minimize side effects

      • Membrane accessibility for drug binding

    • Druggability assessment:

      • Identification of potential binding pockets

      • Structure-based virtual screening

      • Fragment-based drug discovery approaches

  • Resistance Mechanism Insights:

    • If HI_0489 contributes to resistance:

      • Development of inhibitors to restore antibiotic sensitivity

      • Combination therapy approaches targeting both HI_0489 and primary antibiotics

      • Biomarker development for resistance prediction

  • Pathway Targeting Strategies:

    • Identify vulnerabilities in pathways involving HI_0489

    • Develop compounds targeting multiple components of the pathway

    • Design molecules that disrupt protein-protein interactions involving HI_0489

  • Translational Research Roadmap:

    • High-throughput screening against purified HI_0489

    • Whole-cell assays in H. influenzae

    • Lead optimization guided by structure-activity relationships

    • In vivo efficacy studies in infection models

This approach is particularly important given recent findings of "nearly pan-resistant lineages" of H. influenzae and the urgent concern about MDR lineages established globally, highlighting the need for novel antimicrobial strategies .

What role might HI_0489 play in vaccine development for non-typeable Haemophilus influenzae?

The potential role of HI_0489 in vaccine development against non-typeable Haemophilus influenzae (NTHi) should be systematically evaluated:

  • Vaccine Antigen Assessment:

    • Conservation analysis:

      • Sequence conservation across diverse NTHi clinical isolates

      • Identification of conserved epitopes

      • Analysis of selective pressure on different protein regions

    • Immunological evaluation:

      • B-cell epitope prediction and validation

      • T-cell epitope mapping

      • Analysis of immune responses in convalescent patients

  • Membrane Localization Advantages:

    • Surface accessibility analysis based on topology prediction

    • Experimental confirmation of surface exposure

    • Evaluation of accessibility to antibodies

  • Vaccine Formulation Considerations:

    • Recombinant protein approaches using purified HI_0489

    • Peptide-based vaccines targeting conserved epitopes

    • DNA or mRNA vaccine encoding HI_0489

    • Outer membrane vesicle vaccines containing HI_0489

  • Efficacy Evaluation Framework:

    • Animal models of NTHi colonization and infection

    • Assessment of protection against diverse clinical isolates

    • Measurement of functional antibody responses

    • Evaluation of both humoral and cellular immunity

This research direction is highly relevant given recent findings that 91.7% of H. influenzae isolates were non-typeable (NT) in certain populations, and that current Hib vaccines offer no protection against NT strains .

What are the critical research gaps and future directions for HI_0489 investigation?

The most pressing research gaps and future directions for HI_0489 investigation include:

  • Fundamental Knowledge Gaps:

    • Definitive functional characterization

    • Three-dimensional structure determination

    • Physiological role during infection

    • Regulation mechanisms and expression patterns

  • Technical Challenges to Address:

    • Development of specific antibodies against HI_0489

    • Optimization of expression and purification protocols

    • Creation of conditional knockout systems

    • Development of high-throughput functional assays

  • Priority Research Directions:

    • Structure determination using cryo-EM or X-ray crystallography

    • Comprehensive interactome mapping in different conditions

    • In vivo functional studies using animal models

    • Evolutionary analysis across H. influenzae lineages

    • Investigation of potential roles in antibiotic resistance

  • Translational Research Opportunities:

    • Assessment as a diagnostic biomarker

    • Evaluation as a therapeutic target

    • Development of protein-specific inhibitors

    • Exploration as a vaccine component

  • Collaborative Research Framework:

    • Integration with global H. influenzae surveillance

    • Combination with population genomics datasets

    • Multi-disciplinary approaches combining structural biology, genetics, and clinical microbiology

Addressing these research priorities would significantly advance our understanding of HI_0489 and potentially contribute to addressing the urgent concern of increasing antibiotic resistance in H. influenzae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.