Recombinant Haemophilus influenzae Uncharacterized protein HI_0559.1 (HI_0559.1)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus influenzae and HI_0559.1

Haemophilus influenzae is a Gram-negative, non-motile, coccobacillary, facultatively anaerobic, capnophilic pathogenic bacterium belonging to the Pasteurellaceae family. It was first described in 1893 by Richard Pfeiffer during an influenza pandemic, when it was incorrectly identified as the causative agent of influenza, hence its name . H. influenzae is responsible for various localized and invasive infections, particularly in infants and children, including pneumonia, meningitis, and bloodstream infections . Notably, H. influenzae was the first organism to have its entire genome sequenced, marking a significant milestone in genomic research .

The HI_0559.1 protein is designated as "uncharacterized," indicating that its precise biological function has not yet been fully determined. The protein is encoded by the HI_0559.1 gene in the H. influenzae genome and has been assigned the UniProt identification number O86226 . Despite the lack of functional characterization, the protein has been successfully expressed recombinantly and is commercially available for research purposes.

Recombinant Expression Systems

The recombinant HI_0559.1 protein is primarily produced using Escherichia coli expression systems . The full-length protein (amino acids 1-115) is expressed with additional tags, such as histidine tags, to facilitate purification processes. E. coli serves as an efficient host for the production of this bacterial protein, allowing for high yields and relatively straightforward purification protocols.

Purification and Quality Control

The purification of recombinant HI_0559.1 typically employs standard protein purification techniques. For His-tagged versions, immobilized metal affinity chromatography (IMAC) is commonly used. Quality control measures include SDS-PAGE analysis to confirm purity levels, which typically exceed 90% for commercial preparations . The purified protein may be provided as a lyophilized powder or in solution with appropriate stabilizing buffers, depending on the manufacturer and intended application.

Current Research Applications

As an uncharacterized protein, HI_0559.1 represents an opportunity for novel research into Haemophilus influenzae biology. Current research applications may include:

  • Functional characterization studies to determine its role in H. influenzae biology

  • Structural studies to elucidate its three-dimensional conformation

  • Protein-protein interaction studies to identify binding partners

  • Comparative genomics to identify homologs in related bacterial species

  • Immunological studies to assess its potential as an antigen

Potential Future Applications

The availability of recombinant HI_0559.1 opens several avenues for future research and applications:

  • Development of antibodies against HI_0559.1 for detection and characterization

  • Investigation of potential roles in bacterial pathogenesis

  • Exploration of the protein as a potential therapeutic target

  • Integration into structural biology initiatives for membrane protein research

  • Contribution to the functional annotation of the H. influenzae genome

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
As a standard practice, all our proteins are shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
HI_0559.1; Uncharacterized protein HI_0559.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0559.1
Target Protein Sequence
MKSYLKTLIFFPLILQIVVTALLIWFDDDSSGVIVPFSSYALTAFLLAAIPAFLTALLAA KFRYTRYNIASIVLVSSIISFVYCNMASYFYLLLLGEQDTSFWGWLTEGGLSLGL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Uncharacterized protein HI_0559.1?

HI_0559.1 is a conserved hypothetical protein (CHP) predicted to be expressed from an open reading frame in the Haemophilus influenzae genome. This protein consists of 115 amino acids and has been classified as "uncharacterized" because its physiological function remains undetermined despite its presence in the organism's proteome. The protein has a UniProt ID of O86226 and is commercially available as a recombinant protein with an N-terminal His tag expressed in E. coli .

The protein is part of a substantial fraction of proteins in both prokaryotic and eukaryotic proteomes that remain functionally uncharacterized despite being predicted from genome sequencing projects. These uncharacterized proteins represent significant opportunities for discovering novel biological functions and potential therapeutic targets .

What expression systems are most effective for producing recombinant HI_0559.1?

Expression SystemAdvantagesLimitationsBest For
E. coli (standard)High yield, economical, simple protocolsPotential inclusion body formationInitial studies, structural work requiring high yields
E. coli with fusion partners (SUMO, MBP, etc.)Improved solubility, simplified purificationLarger tag size may interfere with functionFunctional studies requiring soluble protein
Insect cells (Sf9, Hi5)Better post-translational modifications, improved foldingMore expensive, slower turnaroundFunctional studies where native conformation is critical
Cell-free systemsAvoids toxicity issues, allows membrane protein expressionLower yields, higher costDifficult-to-express variants, rapid screening

Optimizing expression conditions is crucial, especially given that membrane proteins often present challenges in recombinant expression. Statistical design of experiments (DoE) approaches, similar to those used for other bacterial proteins, can efficiently identify optimal conditions .

What are the recommended storage conditions for maintaining the stability of recombinant HI_0559.1?

For optimal stability of recombinant HI_0559.1, the following storage conditions are recommended:

  • Long-term storage: Store the lyophilized powder at -20°C/-80°C upon receipt.

  • After reconstitution: Add glycerol to a final concentration of 5-50% (50% is recommended) and store in aliquots at -20°C/-80°C.

  • Working solution: Store at 4°C for up to one week; avoid repeated freeze-thaw cycles.

  • Reconstitution medium: Deionized sterile water to a concentration of 0.1-1.0 mg/mL in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose .

The inclusion of trehalose in the storage buffer is particularly important as it acts as a cryoprotectant and stabilizer for proteins, maintaining their native structure during freeze-thaw cycles. The recommendation to avoid repeated freeze-thaw cycles is critical, as membrane proteins are particularly susceptible to denaturation during this process.

What approaches can be employed to determine the function of HI_0559.1?

Determining the function of uncharacterized proteins like HI_0559.1 requires a multi-disciplinary approach combining computational and experimental methods:

  • Computational Approaches:

    • Sequence-based analysis: Search for conserved domains and motifs

    • Structural prediction: Generate models using AlphaFold or similar tools

    • Phylogenetic profiling: Identify co-occurrence patterns across species

    • Gene neighborhood analysis: Examine genomic context for functional clues

    • Protein-protein interaction prediction: Identify potential binding partners

  • Experimental Approaches:

    • Transcriptomic analysis: Determine conditions under which HI_0559.1 is expressed

    • Protein localization studies: Determine subcellular location using tagged variants

    • Knockout/knockdown studies: Observe phenotypic changes in H. influenzae

    • Protein-protein interaction studies: Co-immunoprecipitation, yeast two-hybrid, or proximity labeling

    • Structural studies: X-ray crystallography, NMR, or cryo-EM analysis

    • Ligand binding assays: Identify potential substrates, cofactors, or binding partners

  • Integration of Data:

    • Network analysis to place HI_0559.1 in biological pathways

    • Correlation of experimental findings with computational predictions

    • Comparative analysis with data from related organisms

Given the predicted membrane topology of HI_0559.1, particular attention should be paid to potential roles in transport, signaling, or cell envelope integrity.

How can experimental design approaches optimize recombinant HI_0559.1 expression for functional studies?

Optimization of recombinant protein expression requires systematic evaluation of multiple variables. Applying factorial design methodology, similar to that used for other bacterial proteins, can efficiently identify optimal conditions while minimizing the number of experiments required :

  • Key variables to consider in a factorial design:

    • Induction timing (cell density at induction)

    • Inducer concentration

    • Post-induction temperature

    • Post-induction duration

    • Media composition (particularly nitrogen sources)

    • Presence of solubility enhancers or chaperones

  • Example of a 2^4 factorial design for HI_0559.1 expression:

ExperimentCell Density (OD600)IPTG (mM)Temperature (°C)Duration (h)Soluble Yield (mg/L)
10.40.11816[Measured Result]
20.40.1304[Measured Result]
30.41.0184[Measured Result]
40.41.03016[Measured Result]
50.80.1184[Measured Result]
60.80.13016[Measured Result]
70.81.01816[Measured Result]
80.81.0304[Measured Result]
  • Optimization criteria and validation:

    • Primary response: Yield of soluble, properly folded protein

    • Secondary responses: Purity, specific activity (when assay is available)

    • Validation of optimal conditions in triplicate experiments

Based on similar experimental design approaches used for other bacterial recombinant proteins, conditions that often favor membrane protein expression include lower temperatures (18-25°C), lower inducer concentrations (0.1-0.5 mM IPTG), and longer induction times when using lower temperatures .

What challenges are commonly encountered when attempting structural determination of HI_0559.1?

Structural determination of uncharacterized membrane proteins like HI_0559.1 presents several significant challenges:

  • Membrane protein-specific challenges:

    • Hydrophobic surfaces leading to aggregation during purification

    • Requirement for detergents or membrane mimetics for stability

    • Conformational heterogeneity affecting crystallization

    • Limited crystallizability compared to soluble proteins

    • Challenges in NMR due to size and detergent micelle formation

  • Uncharacterized protein-specific challenges:

    • Lack of functional assays to confirm correct folding

    • Unknown ligands or binding partners that might stabilize structure

    • Difficulty in validating computational models without experimental data

    • Limited information about physiologically relevant oligomerization state

  • Strategies to overcome these challenges:

    • Employing fusion partners that enhance solubility and crystallization

    • Screening multiple detergents and lipid nanodisc compositions

    • Using truncation constructs to remove disordered regions

    • Applying integrative structural biology approaches combining multiple techniques

    • Employing cryo-EM for membrane proteins recalcitrant to crystallization

The absence of known function for HI_0559.1 compounds these challenges, as functional assays typically provide crucial feedback on whether purified protein samples retain native conformation.

How can mass spectrometry contribute to the characterization of HI_0559.1?

Mass spectrometry (MS) offers powerful approaches for characterizing uncharacterized proteins like HI_0559.1, providing insights beyond simple identification :

MS analysis can help determine if the predicted membrane topology of HI_0559.1 is correct by examining the accessibility of different regions to labeling reagents, providing valuable structural information even in the absence of high-resolution structures.

How does HI_0559.1 compare to similar proteins in other bacterial species?

Comparative analysis of HI_0559.1 with homologs in other species can provide valuable functional insights:

  • Sequence homology assessment:

    • BLASTp analysis reveals homologs primarily in Pasteurellaceae family

    • Conservation patterns in related pathogens vs. non-pathogenic species

    • Analysis of selection pressure (dN/dS ratios) across homologs

    • Identification of highly conserved residues as potential functional sites

  • Genomic context analysis:

    • Examination of neighboring genes in H. influenzae and related species

    • Identification of conserved gene clusters or operons

    • Assessment of horizontal gene transfer potential

    • Correlation with the complete genome sequence of H. influenzae Rd

  • Structural comparison:

    • Alignment with structurally characterized proteins from other organisms

    • Conservation of predicted secondary structure elements

    • Identification of potential functional motifs through structural superposition

This comparative approach leverages the extensive genome sequencing data available across bacterial species and may reveal functional associations not evident from studying HI_0559.1 in isolation.

What systems biology approaches can integrate HI_0559.1 into the broader context of H. influenzae biology?

Systems biology approaches provide a holistic framework for understanding the biological role of HI_0559.1:

  • Integration with -omics data sets:

    • Correlation of expression patterns with transcriptomics data

    • Network analysis using proteomic interaction data

    • Metabolomic changes associated with HI_0559.1 perturbation

    • Multi-omics data integration to propose functional hypotheses

  • Contextual analysis within H. influenzae:

    • Association with virulence or colonization phenotypes

    • Response to environmental stressors or host factors

    • Role in biofilm formation or antibiotic resistance

    • Connection to essential cellular processes

  • Computational modeling:

    • Inclusion in genome-scale metabolic models

    • Protein-protein interaction network analysis

    • Machine learning approaches to predict functional associations

    • Flux balance analysis to predict metabolic impact

These approaches place HI_0559.1 within the broader biological context of H. influenzae physiology and pathogenesis, potentially revealing functional roles that might not be apparent from targeted studies of the protein in isolation .

What are potential research applications for HI_0559.1 in understanding H. influenzae pathogenesis?

As an uncharacterized protein from an important human pathogen, HI_0559.1 presents several promising research directions:

  • Potential role in pathogenesis:

    • Investigation as a potential virulence factor

    • Examination of contribution to colonization or invasion

    • Assessment of immunogenicity and potential as vaccine candidate

    • Role in antibiotic resistance or stress response mechanisms

  • Therapeutic target assessment:

    • Evaluation as a novel antimicrobial target

    • Development of inhibitors if function is determined to be essential

    • Use in diagnostic applications for H. influenzae detection

    • Connection to the broader genome sequence information from H. influenzae Rd

  • Fundamental biological insights:

    • Contribution to understanding bacterial membrane biology

    • Potential novel biochemical functions or pathways

    • Evolutionary insights into Pasteurellaceae family

    • Model for approaches to characterize the bacterial "dark proteome"

The worldwide impact of H. influenzae infections, especially in children, underscores the importance of thoroughly understanding all components of its proteome, including uncharacterized proteins like HI_0559.1.

What innovative methodologies are emerging for studying uncharacterized proteins like HI_0559.1?

The field of uncharacterized protein research is rapidly evolving with several emerging technologies and methodologies:

  • AI and machine learning approaches:

    • Advanced function prediction using deep learning models

    • AlphaFold2 and RoseTTAFold for accurate structural prediction

    • Network-based algorithms for functional inference

    • Text mining of literature for implicit functional connections

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing for precise manipulation

    • CRISPRi for titratable gene repression

    • Multiplexed functional genomics screens

    • Site-specific incorporation of non-canonical amino acids for probing function

  • Single-molecule methods:

    • Single-molecule FRET to study conformational dynamics

    • Optical tweezers for mechanical property assessment

    • Super-resolution microscopy for localization studies

    • Nanopore analysis for studying membrane protein conductance

  • Microfluidic technologies:

    • Miniaturized protein separation and characterization

    • Cell sorting for phenotype analysis

    • Affinity assays and spectroscopic analysis at microscale

    • High-throughput screening of function or ligand binding

These emerging methodologies offer new avenues for unraveling the functions of challenging proteins like HI_0559.1, potentially accelerating the pace of discovery and providing deeper insights than conventional approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.