Recombinant Haemophilus influenzae Uncharacterized protein HI_0589 (HI_0589)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
HI_0589; Uncharacterized protein HI_0589
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0589
Target Protein Sequence
MMSYDAETGIAKVKCQSQSTCGACSARETCGTESLSELNGKRGEHIFTLETITPLRTDQM VEIGLEEKSMLFSALLMYIVQLFTLLVATLLSSYISENELIRAILIFMLTALSFVMVKRY TRKLGQQTEFQSVLLRVLF
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0589

STRING: 71421.HI0589

Protein Families
RseC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What defines an uncharacterized protein like HI_0589 in H. influenzae?

HI_0589 represents one of many hypothetical proteins in the H. influenzae genome that have been identified through sequencing but lack experimental functional validation. Such uncharacterized proteins typically constitute 30-50% of microbial genomes, representing a significant portion of bacterial genetic material . This classification results from the rapid accumulation of genomic data through next-generation sequencing technologies outpacing our ability to functionally characterize these gene products.

The characterization of such proteins presents a major challenge in modern biomedical research, particularly as H. influenzae demonstrates pervasive recombination and purifying selection across its genome . Understanding these uncharacterized proteins is essential for comprehending the full functional repertoire of this pathogen.

What bioinformatic approaches can predict the potential function of HI_0589?

Initial functional characterization of uncharacterized proteins like HI_0589 employs a systematic multi-level bioinformatics approach:

  • Sequence homology analysis: Comparing the protein sequence against characterized proteins in databases to identify potential functional homologs

  • Domain and motif identification: Detecting conserved functional domains that might suggest molecular function

  • Structural prediction: Utilizing tools like AlphaFold to predict tertiary structure, which often correlates with function

  • Genomic context analysis: Examining neighboring genes, as functionally related genes are frequently co-located

  • Selection pressure analysis: Calculating dN/dS ratios, with H. influenzae showing widespread evidence of negative selection (average dN/dS value of 0.28)

The proteomics analysis of hypothetical proteins in other bacteria has demonstrated that integrating mass spectrometry-based proteomics with systematic bioinformatics analysis provides a robust approach for functional characterization .

What methods confirm the expression of HI_0589 in H. influenzae?

Experimental confirmation of HI_0589 expression requires multiple complementary approaches:

  • Transcriptomic analysis: RNA-seq to detect mRNA expression of the HI_0589 gene under various conditions

  • Mass spectrometry-based proteomics: The gold standard for confirming protein expression, as demonstrated in studies of hypothetical proteins in other bacteria

  • Western blotting: Using antibodies against the predicted protein for specific detection

  • Reporter gene fusion: Creating fusion constructs with reporter genes to monitor expression patterns

  • Expression data repositories: Checking whether the protein has been detected in previous proteomics studies and deposited in repositories like PRIDE

The confirmation of expression is a crucial first step before proceeding to functional characterization, as not all predicted genes are expressed under standard laboratory conditions.

What strategies optimize recombinant HI_0589 expression for structural studies?

Optimizing recombinant protein expression requires systematic optimization of multiple parameters:

Table 1: Optimization Parameters for Recombinant Protein Expression

ParameterTested RangeOptimal ValueEffect on Protein YieldReference
Mannose concentration3-7 g/L5 g/L↑ 37%
Calcium concentration1-9.5 mM5 mM↑ 27-29%
Culture pH6.5-7.56.85Stabilization
Cell density15-30 × 10^6 vc/mL25 × 10^6 vc/mLOptimal production
CSPR*0.3-0.6 nL/cell/day0.45 nL/cell/dayBalanced nutrient supply

*CSPR: Cell-Specific Perfusion Rate

Beyond these parameters, consider:

  • Expression system selection: Evaluate prokaryotic (E. coli) versus eukaryotic systems based on protein complexity

  • Vector design: Incorporate solubility-enhancing tags and optimized promoters

  • Induction conditions: Optimize inducer concentration, timing, and temperature

  • Purification strategy: Develop a multi-step process involving affinity chromatography, ion exchange, and size exclusion methods

These optimization strategies should be designed using proper experimental power analysis as emphasized in modern research design approaches .

How can genetic manipulation assess HI_0589's role in virulence or antibiotic resistance?

Investigating potential roles in virulence or resistance requires multifaceted genetic approaches:

  • Gene knockout/knockdown construction:

    • CRISPR-Cas9 or homologous recombination methods to generate HI_0589 deletion mutants

    • Creation of conditional expression systems for essential genes

    • Construction of complementation strains to verify phenotype specificity

  • Phenotypic characterization:

    • Growth curve analysis under various stress conditions

    • Biofilm formation assays

    • Antibiotic susceptibility testing using standardized methods

    • Host cell invasion and persistence assays

    • Immune evasion assessment

  • Transcriptomic response:

    • RNA-seq to analyze global transcriptional changes in the mutant

    • qRT-PCR validation of key differentially expressed genes

  • Population genetics context:

    • Analysis of HI_0589 conservation across clinical isolates

    • Examination of selection patterns, as H. influenzae shows evidence of pervasive negative selection across its genome

This systematic approach provides a comprehensive framework for understanding the protein's potential role in pathogenesis.

What experimental approaches identify potential binding partners of HI_0589?

Protein-protein interaction identification requires a multi-technique approach with appropriate controls:

  • Initial screening methods:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • Protein microarrays

  • Interaction validation methods:

    • Biolayer interferometry (BLI)

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Cross-linking mass spectrometry

  • In vivo interaction verification:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Co-localization studies

The experimental design must include appropriate positive and negative controls and follow open research practices that emphasize transparency and reproducibility .

How should structural characterization of purified HI_0589 be approached?

Comprehensive structural characterization employs multiple complementary techniques:

Table 2: Analytical Methods for Structural Characterization

Analytical MethodApplicationInformation ProvidedAdvantagesLimitations
SDS-PAGE with silver stainingPurity assessmentProtein size and purityHigh sensitivityQualitative
Western blotProtein identificationSpecific detectionHigh specificityRequires antibodies
HPLCIntegrity analysisPurity, heterogeneityQuantitativeLimited structural info
Mass spectrometryIdentity confirmationExact mass, modificationsHigh accuracySample preparation critical
Circular dichroismSecondary structureα-helix, β-sheet contentQuick assessmentLow resolution
X-ray crystallographyTertiary structureAtomic resolution structureHighest resolutionRequires crystallization

For complex structural studies:

  • Sample preparation optimization: Ensure protein homogeneity and stability

  • Multiple technique integration: Combine low and high-resolution methods

  • Functional correlation: Connect structural features to predicted functions

  • Quality validation: Implement rigorous quality checks at each stage

All structural data should be deposited in appropriate public databases following open research practices .

What statistical considerations apply to experimental designs involving HI_0589?

Robust statistical approaches are essential for valid experimental interpretation:

  • Power analysis:

    • Conduct a priori power calculations to determine sample size requirements

    • Ensure sufficient biological and technical replicates

    • Consider effect size estimation based on preliminary data

  • Appropriate statistical tests:

    • For continuous variables: t-tests, ANOVA with post-hoc tests

    • For non-parametric data: Mann-Whitney U, Kruskal-Wallis tests

    • For correlation analysis: Spearman's or Pearson's correlation coefficients

  • Multiple testing correction:

    • Apply Benjamini-Hochberg for controlling false discovery rate

    • Use Bonferroni correction for stringent control of family-wise error rate

  • Data presentation guidelines:

    • Present precise numerical values in tables

    • Use figures for trends and patterns

    • Ensure tables are self-explanatory without reference to text

    • Include only relevant data addressing specific research questions

  • Avoiding questionable research practices:

    • Pre-register experimental protocols

    • Report all conducted analyses

    • Distinguish between exploratory and confirmatory analyses

How can evolutionary analysis provide insights into HI_0589 function?

Evolutionary analysis offers valuable functional insights within the context of H. influenzae's highly recombinant genome:

  • Comparative genomics approaches:

    • Analyze the presence/absence of HI_0589 across diverse H. influenzae strains

    • Examine sequence conservation patterns among homologs

    • Identify co-evolving gene pairs that might suggest functional relationships

  • Selection pressure analysis:

    • Calculate dN/dS ratios to assess selective constraints

    • Compare with the average dN/dS value of 0.28 observed across H. influenzae genes

    • Identify specific sites under positive selection that might indicate functional importance

  • Recombination analysis:

    • Assess recombination patterns, considering H. influenzae's rapid linkage disequilibrium decay

    • Evaluate whether HI_0589 is in a recombination hotspot or coldspot

    • Consider implications for horizontal gene transfer

  • Population structure context:

    • Examine HI_0589 variation in the context of H. influenzae's highly admixed population structure

    • Analyze conservation across lineages with different virulence or resistance profiles

This evolutionary framework provides essential context for functional hypotheses.

What bioinformatic pipelines are recommended for analyzing HI_0589 expression data?

RNA-seq data analysis requires a comprehensive pipeline with rigorous quality control:

  • Pre-processing steps:

    • Raw read quality assessment (FastQC)

    • Adapter and low-quality base trimming

    • rRNA sequence filtering

  • Alignment and quantification:

    • Reference genome alignment using HISAT2 or STAR

    • Transcript quantification with featureCounts or Salmon

    • Normalization methods (TPM, FPKM, or variance-stabilizing transformation)

  • Differential expression analysis:

    • Statistical testing using DESeq2 or edgeR

    • Multiple testing correction

    • Log fold change thresholds determination

  • Co-expression analysis:

    • Weighted gene correlation network analysis (WGCNA)

    • Clustering of co-expressed genes

    • Identification of HI_0589-containing modules

  • Data visualization:

    • Follow best practices for data presentation

    • Use tables for precise numerical values

    • Create heatmaps for expression patterns across conditions

    • Generate volcano plots for differential expression results

How can integrated multi-omics approaches enhance understanding of HI_0589 function?

Multi-omics integration provides a comprehensive view of protein function:

Table 3: Multi-omics Integration Approaches for Functional Characterization

Omics LayerTechniquesFunctional InsightsIntegration Strategy
GenomicsWGS, SNP analysisGenetic context, variantsCorrelation with phenotype
TranscriptomicsRNA-seq, qRT-PCRExpression patternsCo-expression networks
ProteomicsMS-based proteomicsProtein expression, PTMsProtein-protein interactions
MetabolomicsLC-MS, NMRMetabolic impactPathway analysis
PhenomicsGrowth assays, Virulence testsFunctional outcomesMulti-level correlation

Integration strategies include:

  • Network-based approaches:

    • Construction of multi-layered networks

    • Module identification across omics layers

    • Network-based functional prediction

  • Statistical integration methods:

    • Canonical correlation analysis

    • Partial least squares regression

    • Multi-omics factor analysis

  • Machine learning approaches:

    • Support vector machines for predictive modeling

    • Random forests for feature importance ranking

    • Deep learning for complex pattern recognition

This integrated approach has proven effective for characterizing hypothetical proteins in other bacterial systems .

What challenges arise in interpreting contradictory data about HI_0589 function?

Resolving contradictory results requires systematic troubleshooting and careful interpretation:

  • Sources of experimental variability:

    • Strain differences in H. influenzae (considering its highly admixed population structure)

    • Growth condition variations affecting gene expression

    • Methodological differences between laboratories

    • Genetic background effects in knockout studies

  • Reconciliation strategies:

    • Multi-condition testing to identify context-dependent functions

    • Complementary methodological approaches

    • Independent validation in multiple laboratories

    • Meta-analysis of available data

  • Contextual considerations:

    • Potential multifunctional nature of the protein

    • Condition-specific roles

    • Interaction with different partners in different contexts

    • Redundancy in functional pathways

  • Experimental design improvements:

    • Increased replication and statistical power

    • More rigorous controls

    • Implementation of open research practices

    • Pre-registration of experimental protocols

  • Data integration challenges:

    • Differing data scales and distributions

    • Temporal disconnects between transcriptomic and proteomic data

    • Technical biases in different omics platforms

By systematically addressing these challenges, researchers can develop a coherent functional model despite initially contradictory data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.