Recombinant Haemophilus influenzae Uncharacterized protein HI_0633 (HI_0633)

How should researchers properly reconstitute and store recombinant HI_0633 for experimental use?

For optimal results when working with recombinant HI_0633, follow this methodological approach:

• Centrifuge the vial briefly prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage

• Aliquot to avoid repeated freeze-thaw cycles

• Store aliquots at -20°C/-80°C for long-term storage

• Working aliquots can be maintained at 4°C for up to one week

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For extended experimental timelines, prepare multiple working aliquots rather than repeatedly accessing the master stock .

What are the typical experimental applications for recombinant HI_0633 protein?

While HI_0633 remains largely uncharacterized, recombinant forms of this protein can be utilized in several research applications:

• SDS-PAGE analysis for protein characterization and antibody validation

• Functional assays to determine potential biological activities

• Structural studies including X-ray crystallography or NMR spectroscopy

• Protein-protein interaction studies using pull-down assays or co-immunoprecipitation

• Antibody production for immunohistochemistry or Western blotting

• Biophysical characterization including circular dichroism or thermal shift assays

The high purity (>90%) of commercially available recombinant HI_0633 makes it suitable for these applications . Researchers should consider the addition of the His-tag when designing experiments, as this modification may influence certain protein-protein interactions or enzymatic activities.

What computational approaches can be used to predict potential functions of uncharacterized HI_0633?

Uncharacterized proteins like HI_0633 can be functionally annotated using a multi-faceted computational approach:

A systematic approach involves:

• Physicochemical characterization using ProtParam for properties like molecular weight, isoelectric point, and hydropathicity

• Domain and motif prediction using multiple databases for cross-validation

• Protein family classification based on evolutionary relationships

• Network analysis to predict functional partners

• Virulence factor prediction using specialized tools like VICMpred and Virulentpred if pathogenic roles are suspected

Integrating results from multiple prediction methods increases confidence in functional assignments, with ROC analysis showing approximately 96.25% accuracy for this integrated approach when tested on H. influenzae proteins with known functions .

How can researchers design expression systems for optimal production of recombinant HI_0633?

To optimize recombinant expression of HI_0633, consider the following methodological approach:

• Vector Selection and Design:

  • For bacterial expression, pET vectors with T7 promoters provide high-level expression

  • Include a His-tag (typically N-terminal) for purification via metal affinity chromatography

  • Consider codon optimization for E. coli if expression levels are low

• Expression Conditions Optimization:

  • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

  • Perform temperature optimization (typically 16-37°C)

  • Optimize induction parameters (IPTG concentration: 0.1-1.0 mM)

  • Consider auto-induction media for higher yields

• Protein Solubility Enhancement:

  • For membrane-associated proteins like HI_0633, include detergents (e.g., DDM, CHAPS)

  • Test fusion partners that enhance solubility (MBP, SUMO, Thioredoxin)

  • Consider periplasmic targeting using appropriate signal sequences

• Purification Strategy:

  • Implement a two-step purification process:
    a. Immobilized metal affinity chromatography (IMAC)
    b. Size exclusion chromatography for final polishing

  • Include low concentrations of reducing agents to prevent disulfide formation

Based on commercial production methods, E. coli appears to be a suitable expression host for HI_0633 , but expression conditions should be optimized for each laboratory's specific requirements and downstream applications.

What are the recommended methods for analyzing potential membrane association of HI_0633?

The amino acid sequence of HI_0633 (MLWDLSGGMVDQRFLVILCMVAFLAGCTQSPVTASVIVMEMTGAQPVLIWLLISSIIASIIISHQFSPKPFYHFAAGCFLQQMQARQAEELRSKTEQEK) suggests potential membrane association . To experimentally verify and characterize this property, employ the following methodological approaches:

• Computational Prediction:

  • Use transmembrane prediction tools (TMHMM, Phobius, HMMTOP)

  • Apply hydropathy plot analysis (Kyte-Doolittle scale)

  • Identify potential signal peptides using SignalP

• Biochemical Fractionation:

  • Perform subcellular fractionation of H. influenzae cells

  • Analyze distribution of HI_0633 in cytoplasmic, membrane, and periplasmic fractions

  • Use Western blotting with anti-HI_0633 antibodies for detection

• Membrane Association Characterization:

  • Perform phase separation using Triton X-114

  • Test membrane extraction with high salt, carbonate, and detergents

  • Conduct flotation assays using density gradients

• Fluorescence Microscopy:

  • Create GFP fusion constructs for localization studies

  • Perform immunofluorescence with anti-HI_0633 antibodies

  • Use membrane-specific dyes for co-localization analysis

• Biophysical Techniques:

  • Circular dichroism to assess secondary structure in membrane-mimetic environments

  • FTIR spectroscopy for structural characterization in lipid environments

  • Liposome binding assays to quantify membrane interaction

The storage recommendations for recombinant HI_0633 in a Tris/PBS-based buffer with 6% Trehalose suggest that additional stabilizers may be beneficial when working with this potentially membrane-associated protein.

How can researchers investigate potential roles of HI_0633 in Haemophilus influenzae pathogenesis?

To systematically investigate HI_0633's potential role in pathogenesis, employ this comprehensive research strategy:

• Genetic Manipulation Approaches:

  • Generate targeted gene knockouts using homologous recombination

  • Create conditional expression strains for essential genes

  • Implement CRISPR-Cas9 for precise genome editing

  • Perform complementation studies to confirm phenotypes

• Phenotypic Characterization:

  • Assess growth kinetics in various conditions (nutrient limitation, stress)

  • Analyze biofilm formation capabilities

  • Evaluate adhesion to host cells using cell culture models

  • Measure invasion efficiency in relevant cell types

• Virulence Assessment:

  • Conduct computational prediction of virulence factors using VICMpred and Virulentpred

  • Perform animal infection models with wild-type and mutant strains

  • Measure bacterial loads in various tissues

  • Analyze immune responses to infection

• Interaction Studies:

  • Identify host cell receptors using pull-down assays

  • Perform protein-protein interaction studies with host factors

  • Analyze effects on host cell signaling pathways

  • Conduct transcriptomics to identify affected host genes

• Structural Biology:

  • Determine 3D structure using X-ray crystallography or cryo-EM

  • Identify potential active sites or binding pockets

  • Perform molecular docking with potential ligands

  • Design structure-based functional experiments

The computational framework for functional annotation of hypothetical proteins from H. influenzae has demonstrated 96.25% accuracy , providing a strong foundation for experimental validation of predicted functions.

What approaches can be used to identify protein-protein interaction partners of HI_0633?

To comprehensively identify protein-protein interaction partners of HI_0633, implement this multi-faceted approach:

• Computational Prediction Methods:

  • STRING database analysis for predicted functional partners

  • Interolog mapping based on homologous interactions

  • Domain-domain interaction predictions

  • Co-expression network analysis

• Affinity Purification Methods:

  • His-tag pull-down assays using recombinant HI_0633

  • Co-immunoprecipitation with anti-HI_0633 antibodies

  • Tandem affinity purification for increased specificity

  • Crosslinking approaches to capture transient interactions

• Proximity Labeling Techniques:

  • BioID or TurboID fusion proteins for in vivo labeling

  • APEX2 proximity labeling

  • Analysis by mass spectrometry for identification

• Direct Binding Assays:

  • Yeast two-hybrid screening

  • Bacterial two-hybrid assays

  • FRET/BRET for in vivo interaction verification

  • Surface plasmon resonance for binding kinetics

• Validation Methods:

  • Co-localization studies using fluorescence microscopy

  • Functional assays to assess biological relevance

  • Mutational analysis of interaction interfaces

  • Competitive binding experiments

Combining multiple methods increases confidence in identified interactions. The His-tagged recombinant form of HI_0633 provides a convenient starting point for pull-down assays , while STRING database analysis can generate initial interaction hypotheses based on genomic context, co-expression, and text mining .

How should researchers address contradictory findings when characterizing HI_0633 function?

When research teams encounter contradictory results in HI_0633 functional characterization, implement this systematic troubleshooting approach:

• Critical Re-examination of Methods:

  • Compare experimental conditions and protocols in detail

  • Review reagent sources and quality control measures

  • Examine sample preparation procedures for differences

  • Assess data collection and analysis methodologies

• Statistical Validation:

  • Perform power analysis to ensure adequate sample sizes

  • Apply appropriate statistical tests for the data type

  • Consider multiple testing corrections for omics datasets

  • Implement ROC analysis to assess prediction accuracy

• Cross-Validation Experiments:

  • Design independent validation experiments

  • Use alternative methodologies to test the same hypothesis

  • Blind testing protocols to reduce experimenter bias

  • Collaborate with independent laboratories for verification

• Reconciliation Strategies:

  • Consider whether contradictions reflect different aspects of a complex function

  • Examine whether experimental conditions influence the observed function

  • Investigate potential strain-specific or context-dependent effects

  • Develop integrative models that explain apparent contradictions

• Collaborative Resolution:

  • Organize collaborative troubleshooting sessions

  • Share raw data and detailed protocols between groups

  • Conduct joint experiments with representatives from each team

  • Document and publish the resolution process

When contradictory findings emerge, approach the discrepancy with a blend of curiosity and scientific skepticism . Understanding that data analysis is an iterative process helps in addressing contradictions constructively, potentially leading to new insights about HI_0633 function that neither team initially considered .

What are common challenges in expressing and purifying recombinant HI_0633, and how can they be addressed?

Researchers working with recombinant HI_0633 may encounter several challenges during expression and purification. Here are methodological solutions to address these issues:

The commercially available recombinant HI_0633 is expressed in E. coli with an N-terminal His-tag , suggesting this is a viable expression system. The recommendation to store the protein with 5-50% glycerol and avoid repeated freeze-thaw cycles indicates potential stability issues that require careful handling .

How can researchers differentiate between technical artifacts and true biological findings when studying HI_0633?

To distinguish between technical artifacts and genuine biological findings when studying HI_0633, implement this systematic validation approach:

• Experimental Controls:

  • Include positive and negative controls in all experiments

  • Perform mock preparations lacking HI_0633

  • Use denatured protein controls for binding specificity

  • Include isotype controls for antibody experiments

• Replication Strategy:

  • Conduct technical replicates (same sample, multiple measurements)

  • Perform biological replicates (independent samples)

  • Repeat experiments on different days

  • Use independent reagent preparations

• Dose-Response Relationships:

  • Test multiple concentrations of recombinant HI_0633

  • Establish quantitative relationships between input and output

  • Verify that effects follow expected biological patterns

  • Calculate EC50/IC50 values where applicable

• Orthogonal Methodology:

  • Confirm findings using alternative techniques

  • Apply complementary approaches with different principles

  • Use both in vitro and in vivo systems when possible

  • Combine biochemical and genetic approaches

• Critical Data Analysis:

  • Apply appropriate statistical methods

  • Perform outlier analysis with clear justification

  • Use data visualization to identify patterns and anomalies

  • Implement blinded analysis to reduce bias

When contradictory results emerge between research groups, consider that both findings may reflect different aspects of HI_0633 biology rather than assuming one is correct and the other erroneous . Collaborative investigation of discrepancies often leads to deeper understanding of complex biological systems.

What are the best practices for validating predicted functions of HI_0633 derived from computational analyses?

To rigorously validate computationally predicted functions of HI_0633, implement this comprehensive validation framework:

• Hierarchical Validation Approach:

  • Begin with in silico cross-validation using multiple prediction tools

  • Progress to biochemical assays based on predicted functions

  • Advance to cellular assays in relevant biological contexts

  • Culminate with in vivo validation in model systems

• Biochemical Validation:

  • Design activity assays based on predicted functional domains

  • Test substrate specificity with structurally related compounds

  • Perform site-directed mutagenesis of predicted catalytic residues

  • Measure kinetic parameters (Km, Vmax, kcat) for enzymatic activities

• Structural Validation:

  • Confirm predicted structural features using CD spectroscopy

  • Perform limited proteolysis to identify domain boundaries

  • Use thermal shift assays to assess ligand binding

  • Determine 3D structure using X-ray crystallography or NMR

• Genetic Validation:

  • Create gene knockouts or knockdowns

  • Perform complementation studies with wild-type and mutant variants

  • Conduct phenotypic analysis aligned with predicted functions

  • Implement genetic suppressor screens

• Systems-level Validation:

  • Analyze protein-protein interaction networks

  • Perform transcriptomic analysis of mutant strains

  • Conduct metabolomic profiling for metabolic functions

  • Use proteomics to identify post-translational modifications

For reliable functional annotation, integrate results from multiple prediction methods as demonstrated in comprehensive studies of H. influenzae hypothetical proteins, where ROC analysis showed approximately 96.25% accuracy for the integrated approach . This systematic validation strategy ensures that computational predictions translate into biologically meaningful insights about HI_0633 function.

What emerging technologies could advance our understanding of HI_0633 function and its role in bacterial biology?

Several cutting-edge technologies hold promise for elucidating the function of HI_0633:

• Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for membrane-associated states

  • Integrative structural biology combining multiple data types

  • AlphaFold2 and other AI-based structure prediction

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

• High-resolution Imaging:

  • Super-resolution microscopy for subcellular localization

  • Single-molecule tracking in live bacteria

  • Correlative light and electron microscopy

  • Expansion microscopy for nanoscale visualization

• Genome Engineering:

  • CRISPR-Cas9 base editing for precise mutations

  • CRISPRi/CRISPRa for functional modulation

  • Multiplexed genome engineering for pathway analysis

  • In vivo directed evolution approaches

• Single-cell Technologies:

  • Single-cell RNA-seq of infected host cells

  • Single-cell proteomics for heterogeneity analysis

  • Microfluidic approaches for bacterial single-cell analysis

  • Spatial transcriptomics of infection models

• Systems Biology Approaches:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

  • Network analysis of protein-protein interactions

  • Flux analysis for metabolic functions

  • Machine learning for pattern recognition in complex datasets

These technologies can be particularly valuable for HI_0633, which remains uncharacterized despite computational prediction efforts . The potential membrane association of HI_0633, suggested by its amino acid sequence , makes techniques like cryo-EM and advanced imaging particularly relevant for understanding its structural context and cellular localization.

How might HI_0633 research contribute to our understanding of bacterial adaptation and pathogenesis?

Research on HI_0633 could provide significant insights into bacterial adaptation and pathogenesis through several avenues:

• Evolutionary Conservation and Adaptation:

  • Comparative genomics across Haemophilus species and other bacteria

  • Analysis of selection pressure on HI_0633 gene

  • Identification of strain-specific variations in clinical isolates

  • Correlation of variations with habitat or host specificity

• Host-Pathogen Interactions:

  • Investigation of potential interactions with host cell receptors

  • Analysis of effects on host innate immune responses

  • Examination of role in adhesion, invasion, or intracellular survival

  • Contribution to immune evasion mechanisms

• Stress Response and Environmental Adaptation:

  • Role in response to oxidative stress in host environments

  • Function in nutrient acquisition during infection

  • Contribution to biofilm formation and maintenance

  • Involvement in antibiotic tolerance mechanisms

• Bacterial Physiology:

  • Position in metabolic or signaling networks

  • Role in membrane integrity or transport

  • Function in cell division or growth regulation

  • Contribution to cell envelope biogenesis

• Therapeutic Target Potential:

  • Assessment as a vaccine candidate

  • Evaluation as a diagnostic biomarker

  • Exploration as a target for novel antimicrobials

  • Development of inhibitors for virulence attenuation

H. influenzae contains 429 hypothetical proteins out of 1,657 total proteins , representing a significant portion of its genome with unknown functions. Characterizing HI_0633 could provide a model for functional analysis of other hypothetical proteins, potentially revealing new aspects of bacterial biology relevant to pathogenesis and adaptation.

What interdisciplinary approaches might reveal new insights about the structure-function relationship of HI_0633?

Exploring the structure-function relationship of HI_0633 would benefit from these interdisciplinary approaches:

• Integrated Structural Biology and Biophysics:

  • Combine X-ray crystallography, NMR, and cryo-EM data

  • Apply molecular dynamics simulations to explore conformational dynamics

  • Use HDX-MS to identify flexible regions and binding interfaces

  • Implement SAXS/SANS for solution structure analysis

• Chemical Biology and Proteomics:

  • Apply activity-based protein profiling to identify catalytic activities

  • Implement photocrosslinking to capture transient interactions

  • Use click chemistry for selective labeling and tracking

  • Perform top-down proteomics for characterizing post-translational modifications

• Synthetic Biology and Engineering:

  • Create chimeric proteins to test domain functionality

  • Implement optogenetic control of HI_0633 activity

  • Design minimal synthetic systems to test functional hypotheses

  • Develop biosensors based on HI_0633 for functional readouts

• Computational Biology and Machine Learning:

  • Apply deep learning for function prediction from sequence and structure

  • Use network analysis to predict functional associations

  • Implement molecular docking and virtual screening for ligand discovery

  • Develop integrative models combining multiple data types

• Systems Microbiology and Host-Pathogen Biology:

  • Analyze HI_0633 in the context of infection models

  • Implement dual RNA-seq to capture host-pathogen dialogue

  • Study temporal dynamics during infection progression

  • Examine tissue-specific roles in various infection sites

The amino acid sequence of HI_0633 suggests potential membrane association , making interdisciplinary approaches particularly valuable for understanding how its structure relates to potential functions in membrane integrity, signaling, or transport. Computational tools have already demonstrated 96.25% accuracy in predicting functions of H. influenzae hypothetical proteins , providing a strong foundation for experimental validation through these interdisciplinary approaches.