Recombinant Haemophilus influenzae Uncharacterized protein HI_0850 (HI_0850)

Shipped with Ice Packs
In Stock

Description

Understanding Recombinant Proteins

Recombinant proteins are produced through genetic engineering, where the gene encoding the protein is inserted into a host organism, such as Escherichia coli (E. coli), to express the protein. This technique allows for large-scale production of proteins for research, therapeutic, and diagnostic purposes.

Characteristics of Recombinant Proteins

  • Expression Host: Typically, E. coli is used for expressing recombinant proteins due to its well-understood genetics and ease of manipulation.

  • Purification: Recombinant proteins are often purified using techniques like affinity chromatography, especially when tagged with sequences like His-tags.

  • Applications: These proteins are used in research to study protein function, in diagnostics to detect diseases, and in therapeutics as vaccines or drugs.

Research on Haemophilus influenzae Proteins

While specific data on HI_0850 is not available, research on other Haemophilus influenzae proteins highlights the importance of understanding bacterial pathogenesis. For example, proteins like Haemophilus influenzae protein E (PE) play crucial roles in adhesion and immune evasion . Additionally, tools like the pTBH plasmid toolkit have been developed to study H. influenzae infection dynamics .

Challenges in Studying Haemophilus influenzae

  • Genetic Diversity: H. influenzae exhibits significant genetic diversity, making it challenging to develop universal diagnostic and therapeutic strategies .

  • Recombination: Frequent genetic recombination with other Haemophilus species complicates species identification and study .

Potential Applications of Recombinant Proteins

Recombinant proteins can be used to develop vaccines, diagnostic tools, and therapeutic agents. For instance, recombinant porins from H. influenzae have been studied for their pore-forming properties .

Data Table: Example of Recombinant Haemophilus influenzae Protein Characteristics

ProteinSourceTagLengthFormPurity
HI_0870.1E. coliHisFull Length (1-96)Lyophilized powder>90%
HI_0234E. coliVariableFull Length (1-48)Liquid/Lyophilized>85%

Note: The table provides characteristics of similar recombinant proteins from Haemophilus influenzae for reference.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipment, as additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development for your order.
Synonyms
HI_0850; Uncharacterized protein HI_0850
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0850
Target Protein Sequence
MLRESAVVISYENGIAKVKCQSQSACGQCAAKNSCGTSSLSELNGKRGEHIFNVETLMPL REGQIVEIGLEEKSMLLSALLMYVVPLLTLLIVTMLSDYISDNEILRAILIFGLTALSFI LVKSYSRKLGQQTEFQPVLLRVLS
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0850

STRING: 71421.HI0850

Protein Families
RseC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.