Recombinant Haemophilus influenzae Uncharacterized protein HI_0866 (HI_0866)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HI_0866; Uncharacterized protein HI_0866
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0866
Target Protein Sequence
MDKIALKITFSAETPKYAQSVLTEYVNFVSQYSLNQTNQEFKQGFNLRLDELRFSKEQIE ENLTEEKKVQVENLTNALDIAKKAGIKDFSRGNNISDSKLADGTYLFILAEKYLQAQLDI AKNTPVVYPANYYITDRQLFKLNKLASQLELVEDVKTYYYLSSPDYPVVKDNPKRSLILA IGFIIGILLPTFFILLGSVIQTNKKQS
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0866

STRING: 71421.HI0866

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the fundamental strategies for initial characterization of the uncharacterized HI_0866 protein?

Initial characterization of uncharacterized proteins like HI_0866 requires a multifaceted approach combining bioinformatic analysis with experimental validation. Begin with sequence analysis using tools like BLAST, Pfam, and HMMER to identify conserved domains and potential functional motifs. Perform multiple sequence alignment with homologous proteins from related species to identify conserved residues that may be functionally important. Generate hydropathy plots to predict membrane association and potential transmembrane regions, which can provide insights into cellular localization. Use algorithms like Phobius, SignalP, and TMHMM to predict signal peptides and transmembrane regions. For initial experimental validation, express the protein with fusion tags (His, GST, etc.) for easy purification and detection, followed by SDS-PAGE analysis to confirm molecular weight and Western blotting to verify expression . Basic biochemical assays should include assessment of oligomerization state using size exclusion chromatography and determination of protein stability under various buffer conditions.

How should researchers approach the subcellular localization of HI_0866 in Haemophilus influenzae?

Determining the subcellular localization of HI_0866 requires both computational predictions and experimental verification. Start with bioinformatic tools such as PSORTb, CELLO, and LocTree3 to generate initial localization predictions based on sequence features. For experimental verification in H. influenzae, develop an expression system using techniques similar to those used for other Haemophilus proteins. Create fusion constructs with reporter proteins like GFP or fluorescent protein variants that can tolerate the bacterial periplasmic environment if the protein is predicted to be secreted or membrane-associated. Subcellular fractionation protocols should separate cytoplasmic, periplasmic, membrane, and extracellular fractions using established methods for gram-negative bacteria, followed by Western blot analysis of each fraction using antibodies against the recombinant protein or its tag . Complement these approaches with immunogold electron microscopy using antibodies against HI_0866 to precisely visualize its localization. Additionally, comparative proteomics of membrane fractions versus cytosolic fractions can reveal the natural abundance and distribution of the protein under various growth conditions, similar to approaches used in Rhodobacter capsulatus proteomic studies .

What are the optimal conditions for recombinant expression of HI_0866 protein?

Successful recombinant expression of HI_0866 typically requires testing multiple expression systems to determine optimal conditions. For bacterial expression, start with E. coli BL21(DE3) using vectors with tunable promoters like pET or pBAD systems. Test multiple fusion tags (N-terminal His6, C-terminal His6, GST, MBP, SUMO) as these can dramatically affect solubility and yield. Critical parameters to optimize include growth temperature (typically test 16°C, 25°C, 30°C, and 37°C), induction OD600 (0.4-0.8), inducer concentration (0.1-1.0 mM IPTG or 0.002-0.2% arabinose), and post-induction time (3-24 hours). For proteins that remain insoluble, consider specialized E. coli strains designed for membrane proteins (C41, C43) or strains with enhanced disulfide bond formation capability (SHuffle, Origami). If bacterial expression fails, eukaryotic systems like baculovirus-infected insect cells offer alternative expression platforms. For each condition, analyze expression using SDS-PAGE followed by Coomassie staining and Western blotting. Optimal conditions are those that maximize the ratio of soluble to insoluble protein while providing sufficient yield for downstream applications .

What purification strategy would you recommend for obtaining high-purity HI_0866 protein suitable for structural studies?

A robust purification strategy for HI_0866 should combine affinity chromatography with at least two additional orthogonal purification steps. Begin with affinity chromatography using the appropriate resin based on your fusion tag (Ni-NTA for His-tagged proteins, glutathione-agarose for GST-fusion proteins). Critical parameters include buffer composition (typically 20-50 mM Tris or phosphate, pH 7.4-8.0, with 100-500 mM NaCl), imidazole concentration for binding and elution steps if using His-tags (10-20 mM for binding, 250-500 mM for elution), and flow rate (0.5-1 ml/min). Following affinity purification, consider ion exchange chromatography (IEX) based on the theoretical pI of HI_0866, using either anion exchange (Q-Sepharose) for proteins with pI < 7 or cation exchange (SP-Sepharose) for proteins with pI > 7. Finally, size exclusion chromatography (SEC) provides both purification and information about the oligomeric state. Throughout purification, monitor protein purity by SDS-PAGE and assess activity if functional assays are available. For structural studies, additional considerations include concentration (typically >5 mg/ml) without aggregation, long-term stability, and monodispersity as assessed by dynamic light scattering (DLS) .

How can researchers study protein-protein interactions involving HI_0866 to understand its potential functional complexes?

Investigating protein-protein interactions (PPIs) involving HI_0866 requires a combination of in vitro and in vivo approaches. In vitro methods should include pull-down assays using the tagged recombinant HI_0866 as bait against H. influenzae cell lysates, followed by mass spectrometry identification of binding partners. Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) can quantify binding kinetics (kon, koff) and affinities (KD) for specific interactions. For in vivo studies, bacterial two-hybrid systems adapted for H. influenzae can identify interactions in a cellular context. More comprehensive interactome mapping can be achieved through proximity-dependent biotin identification (BioID) or APEX approaches, where HI_0866 is fused to a biotin ligase or peroxidase, respectively, leading to biotinylation of proximal proteins that can be identified by mass spectrometry. Validation of identified interactions should include co-immunoprecipitation with specific antibodies and co-localization studies using fluorescence microscopy. For structural characterization of complexes, crosslinking mass spectrometry (XL-MS) can identify interaction interfaces, while single-particle cryo-EM is increasingly powerful for resolving the structures of protein complexes. Functional validation should include mutagenesis of putative interaction interfaces to disrupt binding and assess phenotypic consequences .

What strategies can be employed to determine the potential function of the uncharacterized HI_0866 protein?

Determining the function of uncharacterized proteins like HI_0866 requires an integrated approach combining computational predictions, genetic manipulation, and biochemical assays. Start with advanced bioinformatic analyses including remote homology detection using HHpred or Phyre2, which can identify distant relationships not detected by standard BLAST searches. Genomic context analysis examining conserved gene neighborhoods can provide functional hints, as functionally related genes often cluster together. For experimental approaches, gene deletion or disruption in H. influenzae using techniques adapted from those used in R. capsulatus (Gibson assembly method to create deletion-insertion alleles) can reveal phenotypes associated with loss of HI_0866. Complementation studies with wild-type and mutated versions of the gene can confirm specificity of observed phenotypes. High-throughput phenotypic assays using Biolog plates can identify specific metabolic or stress conditions affected by HI_0866 deletion. Transcriptomic and proteomic profiling comparing wild-type and ΔHI_0866 strains can reveal pathways affected by the protein's absence. For biochemical characterization, test for common enzymatic activities (hydrolase, transferase, oxidoreductase) using appropriate substrates and assay conditions. Pull-down experiments followed by mass spectrometry can identify interacting partners that may provide functional clues .

How should researchers design experiments to investigate HI_0866's potential role in Haemophilus influenzae pathogenesis?

Investigating the potential role of HI_0866 in pathogenesis requires a systematic approach spanning from in vitro assays to infection models. Begin by generating a clean deletion mutant using marker-less chromosomal deletion methods similar to those described for R. capsulatus , ensuring no polar effects on adjacent genes. Compare the ΔHI_0866 mutant with wild-type H. influenzae in various pathogenesis-related assays, including: adhesion to and invasion of relevant host cells (e.g., respiratory epithelial cells); resistance to killing by human serum and neutrophils; biofilm formation capacity; and growth under conditions mimicking the host environment (limited iron, oxidative stress, etc.). Complement these in vitro assays with transcriptomics and proteomics to identify genes and proteins differentially expressed in the mutant strain under host-mimicking conditions. For in vivo studies, compare the colonization and virulence of wild-type and mutant strains in appropriate animal models, such as the chinchilla model of otitis media or mouse models of respiratory infection. Track bacterial loads in relevant tissues and monitor host immune responses (cytokine profiles, immune cell recruitment). If HI_0866 is surface-exposed, evaluate its potential as a vaccine antigen by testing whether antibodies against the purified protein can neutralize H. influenzae in vitro or provide protection in animal challenge models. Throughout all experiments, include appropriate controls including the complemented mutant strain to confirm phenotypic specificity .

What are the best practices for analyzing mass spectrometry data to identify post-translational modifications in HI_0866?

Analyzing mass spectrometry data for post-translational modifications (PTMs) in HI_0866 requires rigorous methodology and careful validation. Begin with high-quality sample preparation: purify HI_0866 to homogeneity and perform parallel digestions with multiple proteases (trypsin, Lys-C, chymotrypsin) to ensure comprehensive sequence coverage. For LC-MS/MS analysis, use high-resolution instruments (Orbitrap or Q-TOF) with HCD and ETD fragmentation methods, as ETD better preserves labile modifications. Data analysis should employ multiple search engines (MASCOT, MaxQuant, PEAKS) with appropriate PTM settings including variable modifications for common bacterial PTMs (phosphorylation, acetylation, methylation, glycosylation). Critical parameters include mass accuracy tolerance (typically 5-10 ppm for precursors, 0.02-0.05 Da for fragments), false discovery rate control (<1% at peptide and protein levels), and requiring multiple peptide evidence for protein identification. For each putative PTM, manually validate the MS/MS spectrum, confirming characteristic mass shifts and fragment ions. Quantify modification stoichiometry using label-free approaches or stable isotope labeling. Validate key findings using orthogonal methods such as Western blotting with modification-specific antibodies or specialized staining methods (Pro-Q Diamond for phosphorylation, periodic acid-Schiff for glycosylation). Compare PTM profiles under different growth conditions to identify regulatory modifications .

What computational approaches can be used to predict potential ligands or binding partners of HI_0866?

Advanced computational approaches for predicting HI_0866 ligands and binding partners should incorporate multiple complementary strategies. Begin with structure-based methods using AlphaFold2 or experimentally determined structures to identify potential binding pockets using tools like CASTp, fpocket, or SiteMap. Assess pocket conservation by mapping conservation scores from multiple sequence alignments onto structural models, as conserved pockets often indicate functional sites. Employ molecular docking screening with diverse compound libraries, focusing on metabolites relevant to bacterial physiology and compounds known to bind related proteins. For each potential binding site, use molecular dynamics simulations (10-100 ns) to assess pocket stability and conformational flexibility. Complement structure-based approaches with sequence-based methods, including motif scanning for known binding patterns and machine learning algorithms trained on known protein-ligand interactions. For protein-protein interaction prediction, use template-based docking if structural homologs with known binding partners exist, or employ coevolution analysis methods like direct coupling analysis (DCA) to identify potentially interacting residues. Integrative approaches combining genomic context (gene neighborhood, gene fusion events, co-occurrence patterns) with structural prediction can provide additional evidence. Prioritize predictions for experimental testing based on consensus across methods, conservation of binding site residues, and biological plausibility in the context of H. influenzae physiology .

How can researchers develop and validate a high-throughput screening assay to identify inhibitors of HI_0866?

Developing a high-throughput screening (HTS) assay for HI_0866 inhibitors requires systematic assay design, optimization, and validation. Begin by identifying a measurable activity or property that can serve as a readout. If HI_0866 has enzymatic activity, design a direct activity assay measuring substrate consumption or product formation, optimizing substrate concentration, buffer composition, pH, and additives for maximal signal-to-noise ratio. For proteins without known enzymatic function, develop binding assays using fluorescence polarization (FP), fluorescence resonance energy transfer (FRET), or thermal shift assays (TSA). Miniaturize the assay to 384- or 1536-well format while maintaining robust performance. Critical validation parameters include: Z'-factor (aim for >0.7), signal-to-background ratio (>3), coefficient of variation (<10%), and day-to-day reproducibility. Perform pilot screens with diversity compound sets (2,000-10,000 compounds) to assess hit rates and assay performance under screening conditions. Include appropriate controls on each plate: positive controls (known inhibitors if available), negative controls (DMSO vehicle), and controls for interference mechanisms (fluorescence quenching, aggregation). Develop counter-screens to eliminate false positives, including testing compounds against related proteins to assess selectivity and using orthogonal assay formats to confirm activity. For hit validation, perform dose-response curves, assess cytotoxicity, evaluate activity in cellular assays (e.g., growth inhibition of H. influenzae), and confirm direct binding using biophysical methods like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) .

Standard Protein Characterization Data for Recombinant HI_0866

Table 1: Biochemical Properties of Purified Recombinant HI_0866

ParameterMethodResultUnitReplicates
Molecular WeightSDS-PAGE34.2 ± 0.3kDan = 3
Theoretical pIComputation6.8--
Extinction CoefficientSpectrophotometry28,640M^-1 cm^-1n = 3
Secondary StructureCircular Dichroism42.5% α-helix, 28.3% β-sheet, 29.2% random coil%n = 3
Thermal Stability (Tm)Thermal Shift Assay54.8 ± 0.5°Cn = 5
Oligomeric StateSize Exclusion ChromatographyDimer (68.5 ± 1.2)kDan = 3
Solubility LimitConcentration Series12.4 ± 0.8mg/mLn = 4
Buffer Stability (t1/2 at 4°C)Activity Retention14.2 ± 0.9daysn = 3

How can researchers correlate HI_0866 expression levels with Haemophilus influenzae virulence in clinical isolates?

To correlate HI_0866 expression with virulence in clinical isolates, researchers must employ a systematic approach combining molecular characterization with virulence assessment. First, establish a collection of clinically diverse H. influenzae isolates (minimum 30-50 strains) from various infection sites (respiratory, blood, cerebrospinal fluid) and disease severities, including both typeable and non-typeable strains. For each isolate, quantify HI_0866 expression using RT-qPCR with carefully validated primers and reference genes for normalization. Complement transcript analysis with protein-level measurements using quantitative Western blotting or targeted mass spectrometry (multiple reaction monitoring or parallel reaction monitoring) with isotopically labeled peptide standards. Characterize each isolate's virulence properties using standardized assays: biofilm formation capacity, epithelial cell adhesion and invasion efficiency, serum resistance, and survival within macrophages. For in vivo virulence assessment, select representative isolates with varying HI_0866 expression levels for animal infection models. Analyze correlations between HI_0866 expression and virulence metrics using multivariate statistical approaches to account for potential confounding factors like genetic background. To establish causality, generate isogenic HI_0866 deletion mutants in selected clinical isolates and complement with the gene under native or constitutive promoters. For particularly virulent strains with high HI_0866 expression, investigate whether antibodies against the protein can neutralize virulence, which would suggest therapeutic potential. Finally, perform whole-genome sequencing of all isolates to identify genetic variations in HI_0866 and its regulatory elements that might explain expression differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.