Recombinant Haemophilus influenzae Uncharacterized protein HI_0976 (HI_0976)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized via recombinant DNA technology, leveraging E. coli expression systems for high yield. Post-purification steps involve affinity chromatography using the His tag, followed by lyophilization to ensure stability. Repeated freeze-thaw cycles are discouraged to prevent degradation .

Potential Biological Relevance

While HI_0976’s exact function is unknown, studies on homologous H. influenzae proteins provide context:

  • Adhesion and Virulence: Proteins like Hap, Hia, and Hsf mediate bacterial adherence to epithelial cells and extracellular matrix (ECM) proteins, facilitating colonization .

  • Vaccine Development: Recombinant outer membrane proteins (e.g., P4, P6) have been tested as vaccine candidates due to their conserved nature and immunogenicity .

Research Applications

  • Antigen Characterization: Used in antibody production and epitope mapping studies.

  • Pathogenicity Studies: Potential involvement in biofilm formation or immune evasion, analogous to Hap autotransporters .

  • Structural Biology: Crystallization or NMR studies to resolve 3D structure .

Limitations and Knowledge Gaps

  • No confirmed pathway or interacting partners are documented .

  • Functional assays (e.g., adhesion, enzymatic activity) have not been reported.

  • Its role in antimicrobial resistance or vaccine efficacy remains unexplored .

Future Directions

  • Functional Annotation: Knockout studies to assess phenotypic changes in H. influenzae.

  • Immunogenicity Testing: Evaluate HI_0976 as a vaccine component, following strategies used for P4/P6 proteins .

  • Proteomic Profiling: Identify binding partners via pull-down assays or yeast two-hybrid screens .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly specify it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
HI_0976; Uncharacterized protein HI_0976
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0976
Target Protein Sequence
MLYQILALLIWSSSLIVGKLTYSMMDPVLVVQVRLIIAMIIVMPLFLRRWKKIDKPMRKQ LWWLAFFNYTAVFLLQFIGLKYTSASSAVTMIGLEPLLVVFVGHFFFKTKQNGFTGYSVQ WHLLAWQF
Uniprot No.

Target Background

Database Links

STRING: 71421.HI0976

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the structure and basic properties of HI_0976?

HI_0976 is an uncharacterized protein from Haemophilus influenzae (strain ATCC 51907/DSM 11121/KW20/Rd) with UniProt accession number Q57147. The protein consists of 128 amino acids in its expression region with the following amino acid sequence: mLYQILALLIWSSSLIVGKLTYSMMDPVLVVQVRLIIAMIIVMPLFLRRWKKIDKPMRKQLWWLAFFNYTAVFLLQFIGLKYTSASSAVTMIGLEPLLVVFVGHFFFKTKQNGFTGYSVQWHLLAWQF . Based on sequence analysis, HI_0976 is predicted to function as a transporter protein, though its specific transport substrate and mechanism remain to be characterized .

How does HI_0976 relate to the pathogenicity of Haemophilus influenzae?

While the direct role of HI_0976 in pathogenicity has not been specifically determined, it exists within the context of a major opportunistic human pathogen. Haemophilus influenzae causes both non-invasive and invasive disease, with increasing reports of multi-drug resistance (MDR) globally . Understanding uncharacterized proteins like HI_0976 may provide insights into novel drug targets or virulence mechanisms. Recent population genetic analyses of nearly 10,000 H. influenzae genomes revealed highly admixed population structure with evidence of pervasive negative selection, suggesting complex evolutionary dynamics in this pathogen .

What expression systems are recommended for producing recombinant HI_0976?

For laboratory research purposes, E. coli-based expression systems have been successfully employed to produce recombinant HI_0976 with His-tag modifications . When expressing recombinant HI_0976, researchers should consider codon optimization for the expression host, as H. influenzae has different codon usage patterns than common laboratory expression systems. Additionally, the hydrophobic regions in the sequence suggest it may be a membrane protein, potentially requiring specialized expression and purification protocols to maintain proper folding and function.

What methodological approaches are most effective for functional characterization of uncharacterized transporters like HI_0976?

For functional characterization of putative transporters like HI_0976, a multi-faceted approach is recommended:

  • Transport assays: Design radioactive or fluorescently labeled substrate uptake experiments in reconstituted liposomes or whole cells expressing HI_0976.

  • Structural studies: Apply X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine three-dimensional structure, which may provide insights into substrate binding sites and transport mechanisms.

  • Homology modeling: Utilize bioinformatic approaches to identify structural homologs and predict function based on conserved domains.

  • Site-directed mutagenesis: Systematically alter potentially important residues to assess their role in transport activity.

  • Protein-protein interaction studies: Employ pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to identify interaction partners that may provide functional clues .

A well-designed functional characterization should incorporate multiple complementary techniques to overcome the limitations inherent in any single approach.

How might proteomic approaches be employed to investigate the role of HI_0976 in host-pathogen interactions?

Proteomic approaches offer powerful tools for understanding the role of HI_0976 in host-pathogen interactions:

  • Differential expression analysis: Compare protein expression levels of wild-type and HI_0976 knockout strains during infection using iTRAQ (isobaric tags for relative and absolute quantitation) mass spectrometry .

  • Protein interaction networks: Identify host proteins that interact with HI_0976 using proximity labeling methods such as BioID or APEX.

  • Post-translational modifications: Characterize changes in phosphorylation, glycosylation, or other modifications that may regulate HI_0976 function during infection.

  • Multiple reaction monitoring (MRM): Develop targeted assays to quantify HI_0976 expression across different infection conditions with high sensitivity .

The table below illustrates an example of how quantitative proteomic data might be represented for proteins of interest during infection (adapted from similar proteomic studies):

ProteinFunctionFold Change During Infectionp-value
HI_0976Unknown transporter[Hypothetical values][Hypothetical values]
Related transportersComparison proteins[Hypothetical values][Hypothetical values]

What is the current understanding of HI_0976 conservation across Haemophilus influenzae strains and its implications for research?

Analysis of nearly 10,000 H. influenzae genomes (combining over 4,000 newly sequenced isolates with approximately 6,000 published genomes) has revealed important insights into the species' global population structure . While specific data on HI_0976 conservation is not directly provided in the search results, the broader analysis shows:

  • The H. influenzae population exhibits a highly admixed structure

  • There is relatively low core genome nucleotide diversity

  • Evidence of pervasive negative selection exists across the genome

For researchers, these findings suggest that when studying HI_0976:

  • Comparative genomic approaches should include diverse isolates from multiple lineages

  • The level of conservation of HI_0976 across strains may indicate its functional importance

  • Any identified variants should be evaluated in the context of potential selection pressures

What experimental design considerations are critical when investigating the function of HI_0976?

When designing experiments to investigate HI_0976 function, researchers should consider:

  • Control selection: Include appropriate positive and negative controls. For example, when testing transport function, include known transporters with similar predicted structure as positive controls and non-transporter membrane proteins as negative controls .

  • Experimental grouping: Choose between independent measures design (different samples for each condition) or repeated measures design (same samples across multiple conditions) based on your research question and available resources .

  • Variable management:

    • Independent variable: Typically the presence, absence, or mutation of HI_0976

    • Dependent variables: Measurable outcomes like growth rate, transport activity, or virulence

    • Control variables: Factors held constant across experimental groups

    • Extraneous variables: Factors to be randomized or controlled for

  • Statistical power: Ensure sufficient replication to detect meaningful differences between experimental groups. Power analysis should be conducted during experimental planning .

  • Blinding procedures: Implement when possible to reduce experimenter bias, particularly for phenotypic assessments.

How should knockout or knockdown studies of HI_0976 be designed and validated?

For effective knockout or knockdown studies of HI_0976:

  • Design strategy:

    • Complete gene deletion: Use homologous recombination to replace HI_0976 with an antibiotic resistance cassette

    • CRISPR-Cas9: Design guide RNAs targeting specific regions of HI_0976

    • Conditional knockdown: Implement an inducible system if HI_0976 is essential

  • Validation methods:

    • PCR verification: Confirm genetic modification at the DNA level

    • RT-qPCR: Verify reduced or absent mRNA expression

    • Western blot: Confirm protein absence using specific antibodies

    • Complementation: Restore wild-type phenotype by reintroducing functional HI_0976

  • Phenotypic characterization:

    • Growth curves under various conditions

    • Transport assays (if suspected transporter function)

    • Infection models (if pathogenicity is being studied)

    • Stress response testing

  • Controls:

    • Wild-type strain

    • Complemented knockout strain

    • Knockout of unrelated gene (to control for general effects of genetic manipulation)

What approaches are recommended for studying potential interactions between HI_0976 and host proteins?

To investigate potential interactions between HI_0976 and host proteins:

  • In vitro interaction studies:

    • Pull-down assays using purified recombinant HI_0976 with His-tag

    • Surface plasmon resonance to measure binding kinetics

    • ELISA-based interaction assays

  • Cell-based approaches:

    • Bacterial two-hybrid systems for initial screening

    • Co-immunoprecipitation from infected host cells

    • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

  • Proximity labeling techniques:

    • BioID fusion proteins to identify proteins in close proximity to HI_0976 during infection

    • APEX2 tagging for temporal control of labeling

  • Validation of interactions:

    • Mutational analysis of interaction interfaces

    • Competition assays with peptides derived from interaction regions

    • Functional assays to determine the biological significance of identified interactions

How should researchers approach contradictory results when characterizing HI_0976?

When confronted with contradictory results in HI_0976 characterization:

  • Methodological assessment: Evaluate differences in experimental methods, reagents, and conditions that might explain discrepancies. For example, different expression tags or buffer conditions might affect protein function .

  • Strain variation: Consider if results differ due to genetic variation between H. influenzae strains used. Recent genomic analyses have identified substantial genetic diversity and evidence of horizontal gene transfer across H. influenzae isolates .

  • Technical validation: Employ alternative techniques to verify contradictory findings. If transport function results are inconsistent, verify using multiple independent assay systems.

  • Physiological context: Examine whether contradictions might reflect true biological complexity dependent on specific conditions or cellular contexts.

  • Statistical rigorous reanalysis: Apply appropriate statistical methods to determine if apparent contradictions are statistically significant or within expected variation .

  • Meta-analysis approach: Systematically integrate all available data using formal meta-analysis techniques to identify consistent patterns despite apparent contradictions.

What bioinformatic approaches are most valuable for predicting the function of HI_0976?

For predicting HI_0976 function through bioinformatics:

  • Sequence-based predictions:

    • Homology searches using BLAST, HHpred, or HMMER against characterized protein databases

    • Identification of conserved domains using InterPro, Pfam, or CDD

    • Transmembrane topology prediction using TMHMM, Phobius, or TOPCONS for this putative transporter

  • Structural predictions:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Molecular dynamics simulations to identify potential substrate binding sites

    • Comparative modeling based on solved structures of homologous transporters

  • Genomic context analysis:

    • Examination of genomic neighborhood for functionally related genes

    • Analysis of gene co-occurrence patterns across bacterial species

    • Identification of regulatory elements that might indicate conditions of expression

  • Evolutionary analysis:

    • Phylogenetic profiling to identify organisms with HI_0976 homologs

    • Selection pressure analysis (dN/dS ratios) to identify conserved functional regions

    • Analysis of the highly admixed population structure and evidence of negative selection observed in H. influenzae

How can proteomics data be effectively integrated with genomic and phenotypic data when studying HI_0976?

For integrating multiple data types in HI_0976 research:

  • Multi-omics data integration platforms:

    • Utilize tools like Perseus, Skyline, or Galaxy for processing and initial integration

    • Apply systems biology approaches to model relationships between genomic variations, protein expression, and phenotypic outcomes

  • Correlation analyses:

    • Examine correlations between HI_0976 sequence variants and protein expression levels

    • Map relationships between protein abundance and specific phenotypes

    • Use methodologies similar to those employed in proteomic characterization studies, such as iTRAQ or MRM approaches

  • Network-based integration:

    • Construct protein-protein interaction networks incorporating HI_0976

    • Develop functional association networks based on co-expression patterns

    • Map potential roles in virulence networks based on phenotypic data

  • Visualization strategies:

    • Create interactive visualizations that allow exploration of relationships across data types

    • Develop integrated dashboards for analyzing experimental results in context

  • Machine learning approaches:

    • Apply supervised learning to predict functional outcomes from integrated data

    • Use unsupervised learning to identify patterns across diverse datasets

    • Employ feature importance analysis to identify key factors affecting HI_0976 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.