Recombinant Haemophilus influenzae Uncharacterized protein HI_1127 (HI_1127)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Haemophilus influenzae Uncharacterized Protein HI_1127 (HI_1127) is a protein derived from the bacterium Haemophilus influenzae . Haemophilus influenzae is a Gram-negative, coccobacillary, facultatively anaerobic bacterium known to cause localized and invasive infections . HI_1127 is referred to as an uncharacterized protein because its specific function within the bacterium is not yet well understood .

Characteristics:

  • Source: Typically produced in E. coli but can also be expressed in Yeast, Baculovirus, or Mammalian Cells .

  • Tag: Often fused to an N-terminal His tag to facilitate purification .

  • Length: Full Length (1-138 amino acids) .

  • Form: Usually available as a lyophilized powder .

  • Purity: Greater than 85-90% as determined by SDS-PAGE .

  • Storage: Stored at -20°C to -80°C to maintain stability, avoiding repeated freeze-thaw cycles .

  • Reconstitution: Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the potential addition of glycerol for long-term storage .

  • UniProt ID: O86234

Production and Quality Control

Recombinant HI_1127 is commonly produced in E. coli, yeast, baculovirus, or mammalian cells . The protein is often expressed with a His-tag, which allows for purification using affinity chromatography .

Purification Steps:

  1. Expression: The gene encoding HI_1127 is expressed in a host organism (E. coli, yeast, baculovirus, or mammalian cells) .

  2. Cell Lysis: The cells are lysed to release the protein .

  3. Affinity Chromatography: The lysate is passed through an affinity column (e.g., nickel column for His-tagged proteins), where the HI_1127 protein binds to the column .

  4. Washing: The column is washed to remove any non-specifically bound proteins .

  5. Elution: HI_1127 is eluted from the column using a specific buffer .

  6. Quality Control: The purified protein is assessed for purity and integrity using SDS-PAGE and other methods .

Applications in Research

While HI_1127 is an uncharacterized protein, recombinant forms are useful in research contexts . Potential applications include:

  • Vaccine Development: Recombinant HI_1127 protein can be explored as a potential vaccine candidate .

  • ELISA Assays: Useful as a reagent in Enzyme-Linked Immunosorbent Assays (ELISAs) for detecting antibodies against Haemophilus influenzae .

  • Structural Studies: Can be used for determining the three-dimensional structure of the protein, which may provide insights into its function.

  • Protein-Protein Interaction Studies: Employed in experiments to identify other proteins that interact with HI_1127, which could help elucidate its role in Haemophilus influenzae .

Limitations and Considerations

  • Research Use Only: Recombinant proteins are intended for research purposes and not for direct use in humans or animals .

  • Purity and Endotoxin Levels: Ensure the protein is of high purity and has low endotoxin levels, especially if used in cell-based assays or in vivo studies .

  • Characterization: As an uncharacterized protein, further studies are needed to determine its precise function and role in Haemophilus influenzae .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To ensure a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
HI_1127; Uncharacterized protein HI_1127
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1127
Target Protein Sequence
MLHAKVVYDSSLHFLGFIGGIFAILGVIVLPITSGDTAFRAARLQIAEIFNVDQRSLPKR LLIAVPLFVLGYFISTIDFSVLWRYFTWANQMTAMVMLWTAAGYLYRYHKFHWVASLPAW FITTVCALICSTTKLVSA
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae Uncharacterized protein HI_1127?

Haemophilus influenzae Uncharacterized protein HI_1127 (Uniprot NO: O86234) is a protein expressed by the pathogenic bacterium H. influenzae strain ATCC 51907/DSM 11121/KW20/Rd. It consists of 138 amino acids and is classified as a hypothetical protein, meaning its existence is predicted from genomic data while its function remains largely unknown . Analysis of its amino acid sequence suggests it contains multiple hydrophobic regions consistent with membrane localization, indicating it may function as a transmembrane protein. Hypothetical proteins like HI_1127 represent a substantial fraction of prokaryotic proteomes and present significant research opportunities for discovering novel biological functions .

How should researchers properly store and handle recombinant HI_1127?

According to product specifications, recombinant HI_1127 requires careful handling for optimal experimental results:

Storage ParameterRecommendation
Primary Storage-20°C (short-term)
Extended Storage-20°C or -80°C
Buffer CompositionTris-based buffer with 50% glycerol
Working AliquotsStore at 4°C for up to one week
Important PrecautionsAvoid repeated freeze-thaw cycles
ReconstitutionFollow protein-specific protocols

These storage conditions are optimized to maintain protein stability and functionality for research applications . Improper storage can lead to protein degradation and compromise experimental results.

How is Haemophilus influenzae relevant to human disease research?

Haemophilus influenzae is a major opportunistic human pathogen causing both non-invasive and invasive diseases. Despite the effectiveness of the H. influenzae type b (Hib) vaccine in reducing invasive Hib disease, non-typeable H. influenzae strains remain a significant public health burden worldwide . Recent research has highlighted concerning trends:

  • Increasing reports of multi-drug resistant (MDR) strains globally

  • 91.7% of isolates in recent studies were non-typeable (NT) strains

  • Evidence of highly admixed population structure and pervasive negative selection

  • The ability to cause invasive disease is not restricted to specific subpopulations

Understanding uncharacterized proteins like HI_1127 may provide insights into bacterial adaptation, virulence mechanisms, and potential therapeutic targets to address these emerging challenges.

Why is research on uncharacterized proteins like HI_1127 important?

Research on uncharacterized proteins serves several critical scientific functions:

  • Discovery of Novel Functions: Hypothetical proteins often represent undiscovered biological mechanisms and molecular functions .

  • Therapeutic Target Identification: Novel proteins may reveal unique vulnerabilities for antimicrobial development .

  • Evolutionary Insights: Studying proteins specific to certain bacterial lineages helps trace evolutionary adaptations.

  • Systems Biology Completion: Complete understanding of cellular pathways requires characterization of all constituent proteins.

  • Structural Biology Advancement: Novel protein structures expand our knowledge of protein folding and function relationships.

For H. influenzae specifically, characterizing proteins like HI_1127 may reveal factors contributing to its adaptability, virulence, and increasing antibiotic resistance .

How does HI_1127 relate to pathogenicity in Haemophilus influenzae?

While the specific role of HI_1127 in pathogenicity remains undetermined, several contextual factors suggest potential significance:

Pathogenicity FactorRelationship to HI_1127
Cell InvasionMembrane proteins often mediate host-pathogen interactions; TREP studies have identified invasion factors like HMW1 adhesin
Antibiotic ResistanceMembrane proteins can function in efflux systems contributing to resistance
Biofilm FormationSurface proteins frequently participate in bacterial adherence and biofilm development
Environmental AdaptationMembrane proteins help bacteria sense and respond to changing host conditions
Immune EvasionSurface proteins may contribute to evasion of host immune responses

Research by Mell et al. demonstrated how transformed recombinant enrichment profiling (TREP) could identify genetic factors like HMW1 adhesin involved in intracellular invasion by H. influenzae . Similar approaches could determine whether HI_1127 contributes to virulence mechanisms.

What methodological approaches are most effective for studying uncharacterized proteins like HI_1127?

Characterizing uncharacterized proteins requires a multi-faceted approach combining computational and experimental methods:

ApproachTechniquesApplications for HI_1127
Bioinformatic AnalysisSequence alignment, structural prediction, motif identificationInitial functional hypotheses, evolutionary context
Genetic ManipulationGene knockout, overexpression, complementation studiesPhenotypic impact assessment
Protein-Based MethodsProtein expression, purification, biochemical assaysDirect functional characterization
Structural StudiesX-ray crystallography, NMR, cryo-EMStructural insights into function
Interaction StudiesCo-IP, pull-down assays, crosslinking, Y2HIdentifying protein partners
Functional GenomicsRNA-Seq, proteomics, metabolomicsSystem-level impact analysis
Transformed Recombinant Enrichment Profiling (TREP)Natural transformation, phenotypic selection, deep sequencingGenetic architecture of specific phenotypes

A systematic approach combining multiple methods provides the most comprehensive understanding of HI_1127's function and biological significance.

How can researchers apply Transformed Recombinant Enrichment Profiling (TREP) to study HI_1127?

TREP is a powerful method particularly suitable for naturally competent bacteria like H. influenzae. This methodology has successfully identified factors like HMW1 adhesin involved in intracellular invasion . For studying HI_1127, TREP could be implemented as follows:

  • Experimental Setup:

    • Generate a donor strain with modified HI_1127 (tagged or mutated)

    • Create recipient strains lacking or containing wild-type HI_1127

    • Use natural transformation to generate recombinant pools

    • Apply selective pressure based on hypothesized HI_1127 function

  • Phenotypic Selection Examples:

    • Invasion assays using airway epithelial cells if adhesion/invasion is suspected

    • Antibiotic exposure if resistance mechanisms are hypothesized

    • Biofilm formation selection if surface adhesion is proposed

  • Deep Sequencing and Analysis:

    • Sequence selected populations to identify enriched genetic variants

    • Compare with control populations to identify HI_1127-specific effects

    • Validate findings through targeted genetic manipulation

  • Advantages for HI_1127 Research:

    • Leverages natural genetic variation and competence

    • Allows unbiased screening of genetic determinants

    • Can identify genetic interactions beyond direct effects

    • Particularly suitable for membrane proteins with challenging direct biochemical characterization

What experimental challenges should researchers anticipate when studying membrane proteins like HI_1127?

Membrane proteins present unique experimental challenges requiring specialized approaches:

ChallengeImpactMitigation Strategies
Expression DifficultiesLow yield, inclusion body formationUse specialized expression systems (C41/C43 E. coli strains), codon optimization
Protein StabilityDenaturation outside lipid environmentEmploy detergents, nanodiscs, or amphipols to maintain native conformation
Purification ComplexityDetergent interference, aggregationOptimize detergent selection, use affinity tags, size exclusion chromatography
Structural DeterminationDifficulties in crystallizationConsider cryo-EM, solid-state NMR, or fragment-based approaches
Functional AssaysReconstitution in artificial membranes requiredLiposome reconstitution, electrophysiology, transport assays
Antibody GenerationPoor immunogenicity of hydrophobic regionsUse peptide antigens from hydrophilic loops, phage display antibodies
Interaction StudiesMembrane disruption affects interactionsMembrane-specific yeast two-hybrid, proximity labeling (BioID, APEX)

These challenges necessitate careful experimental design and often require multiple complementary approaches to achieve reliable characterization.

How can structural prediction tools help understand the function of HI_1127?

Modern structural prediction tools can provide valuable insights into potential functions of uncharacterized proteins like HI_1127:

  • Structure Prediction Pipeline:

    • Use multiple tools (AlphaFold, I-TASSER, Phyre2) to generate structural models

    • Assess prediction confidence through metrics like pLDDT scores

    • Compare predictions to identify consistent structural features

    • Validate predictions through experimental approaches when possible

  • Functional Insights from Structure:

    • Identify potential binding pockets or catalytic sites

    • Detect structural similarity to characterized proteins

    • Analyze electrostatic surface properties for interaction potential

    • Predict membrane topology and orientation

  • Experimental Design Guidance:

    • Target specific residues for mutagenesis based on structural predictions

    • Design truncated constructs based on domain predictions

    • Inform protein engineering strategies

    • Guide antibody generation by identifying accessible epitopes

  • Integration with Other Data:

    • Combine structural predictions with evolutionary conservation analysis

    • Correlate structure with transcriptomic/proteomic data

    • Use structure to interpret phenotypic effects of mutations

    • Predict potential drug binding sites for therapeutic development

Structural prediction can significantly narrow down functional hypotheses and guide targeted experimental validation, accelerating the characterization process significantly.

What comparative genomics approaches can provide insights into HI_1127 function?

Comparative genomics offers powerful strategies to contextualize HI_1127 and generate functional hypotheses:

ApproachMethodologyPotential Insights for HI_1127
Ortholog AnalysisIdentify HI_1127 equivalents across bacterial speciesEvolutionary conservation patterns, taxonomic distribution
Synteny AnalysisExamine gene neighborhood conservationPotential functional relationships, operonic structure
Strain VariationCompare HI_1127 across clinical isolatesSelection pressure, virulence association
Phylogenetic ProfilingCorrelate presence/absence with phenotypic traitsFunctional prediction based on co-occurrence
Horizontal Gene Transfer DetectionAnalyze GC content, codon usagePotential acquisition from other species
Pan-genome AnalysisCore vs. accessory genome placementEssentiality insights, strain-specific adaptation
Selection Pressure AnalysisdN/dS ratios, McDonald-Kreitman testEvolutionary constraints, adaptive selection

Recent genome sequencing of over 4,000 H. influenzae isolates from carriage and pneumonia cohorts provides a rich resource for comparative analysis . This dataset revealed highly admixed population structure and evidence of pervasive negative selection that could inform HI_1127 analysis.

How can multi-omics approaches be integrated to study HI_1127?

Integrating multiple omics approaches provides a comprehensive understanding of HI_1127's biological context:

  • Experimental Design Considerations:

    • Use consistent experimental conditions across platforms

    • Include appropriate controls and biological replicates

    • Design time-course studies to capture dynamic processes

    • Consider perturbation experiments (e.g., stress conditions)

  • Multi-omics Data Collection:

    • Genomics: Sequence variation across strains

    • Transcriptomics: Expression patterns of HI_1127 and co-regulated genes

    • Proteomics: Protein abundance, post-translational modifications

    • Metabolomics: Metabolic changes associated with HI_1127 manipulation

    • Interactomics: Protein-protein and protein-DNA interactions

  • Integrated Analysis Strategies:

    • Correlation analysis across omics layers

    • Network construction and pathway enrichment

    • Causal inference modeling

    • Machine learning for pattern identification

  • Visualization and Interpretation:

    • Multi-dimensional data visualization

    • Pathway mapping across omics layers

    • Temporal dynamics visualization

    • Interactive exploration tools

This integrated approach can reveal HI_1127's role in cellular networks and identify conditions where it plays critical functions, potentially informing therapeutic strategies targeting multi-drug resistant H. influenzae strains .

What are the best practices for analyzing data from HI_1127 experiments?

  • Experimental Design Considerations:

    • Include appropriate controls (positive, negative, vehicle)

    • Use sufficient biological and technical replicates

    • Consider power analysis to determine sample size

    • Account for batch effects and confounding variables

  • Data Quality Assessment:

    • Check for normality and homogeneity of variance

    • Identify and handle outliers appropriately

    • Assess technical and biological variation

    • Validate measurement accuracy and precision

  • Statistical Approaches:

    • Select appropriate tests based on data distribution

    • Apply multiple testing correction for high-throughput data

    • Use parametric or non-parametric methods as appropriate

    • Consider Bayesian approaches for complex datasets

  • Advanced Analysis Methods:

    • Clustering for pattern identification

    • Dimensionality reduction for complex datasets

    • Network analysis for interaction studies

    • Machine learning for predictive modeling

  • Software and Tools:

    • R/Bioconductor for statistical analysis

    • Python for data processing and machine learning

    • Specialized tools for specific data types (e.g., proteomics)

    • Version control for reproducible analysis

How should researchers effectively present data tables and figures for HI_1127 research?

Effective data presentation is crucial for communicating research findings on uncharacterized proteins like HI_1127. Following established best practices ensures clarity and impact:

Data Tables Best Practices:

  • Keep tables simple and focused on specific comparisons

  • Use clear descriptive titles that summarize content

  • Place dependent variables in columns for easier comparison

  • Include appropriate statistical measures (standard deviation, p-values)

  • Use footnotes for definitions rather than additional columns

  • Limit horizontal lines and avoid vertical lines for readability

Figures Best Practices:

  • Select appropriate visualization types based on data characteristics :

    • Line graphs for temporal or continuous data trends

    • Bar graphs for discrete comparisons

    • Avoid 3D graphs that can distort data perception

  • Maintain consistent formatting and color schemes

  • Include clear labels and units on all axes

  • Use appropriate statistical indicators (error bars, significance markers)

  • Ensure figures are self-explanatory with comprehensive legends

Example Table Format for HI_1127 Expression Analysis:

ConditionHI_1127 Expression Level (fold change)Standard Deviationp-value*
Standard growth1.000.12-
Serum exposure2.470.310.003
Epithelial cell contact3.860.45<0.001
Antibiotic stress0.540.090.042

*p-values calculated using Student's t-test comparing to standard growth condition

This format provides clear, precise information while maintaining readability and highlighting significant findings .

How can researchers design rigorous experiments to determine HI_1127's potential role in pathogenesis?

Designing rigorous experiments to investigate HI_1127's role in pathogenesis requires careful planning and controls:

  • Hypothesis Formulation and Initial Characterization:

    • Perform bioinformatic analysis to generate testable hypotheses

    • Analyze HI_1127 expression under infection-relevant conditions

    • Determine cellular localization and potential interactions

  • Genetic Manipulation Strategy:

    • Generate clean deletion mutants using allelic exchange

    • Create complemented strains expressing wild-type HI_1127

    • Develop site-directed mutants targeting predicted functional residues

    • Construct reporter strains to monitor expression dynamics

  • In Vitro Infection Models:

    • Adhesion Assays: Quantify bacterial attachment to relevant host cells

      • Methodology: CFU counts, immunofluorescence, flow cytometry

      • Controls: ΔhmwA mutant (known adhesion defect), wild-type strain

    • Invasion Assays: Measure intracellular bacterial populations

      • Methodology: Gentamicin protection assay, differential staining

      • Controls: Wild-type, known invasion-deficient mutants

    • Biofilm Formation: Assess ability to form multicellular communities

      • Methodology: Crystal violet staining, confocal microscopy

      • Controls: Known biofilm-deficient strains, complemented mutants

  • Host Response Evaluation:

    • Cytokine production measurement

    • Cell signaling pathway activation

    • Transcriptional response in host cells

    • Reactive oxygen species generation

  • Experimental Design Considerations:

    • Use multiple clinical isolates to ensure generalizability

    • Include appropriate positive and negative controls

    • Perform time-course experiments to capture dynamics

    • Blind experimenters to sample identity when possible

    • Use sufficient biological and technical replicates

  • Validation Approaches:

    • Phenotype rescue with complementation

    • Heterologous expression studies

    • In vitro biochemical confirmation of predicted activities

    • Correlation with clinical isolate characteristics

This systematic approach ensures that any role attributed to HI_1127 in pathogenesis is supported by multiple lines of evidence and controls for experimental variables that could confound interpretation .

How might HI_1127 research contribute to addressing multi-drug resistance in Haemophilus influenzae?

Recent research has identified alarming trends in multi-drug resistance (MDR) in H. influenzae, with multiple nearly pan-resistant lineages emerging globally . HI_1127 research could contribute to addressing this challenge through several avenues:

  • Novel Target Identification:

    • If HI_1127 proves essential for bacterial survival or virulence, it could represent a novel therapeutic target

    • Membrane proteins often make excellent drug targets due to accessibility

    • Uncharacterized proteins may offer unique mechanisms not targeted by existing antibiotics

  • Resistance Mechanism Insights:

    • If HI_1127 contributes to antibiotic resistance (e.g., as part of an efflux system), understanding its mechanism could inform inhibitor development

    • Comparative genomics across resistant vs. susceptible strains could reveal correlations with HI_1127 variants

  • Diagnostic Development:

    • HI_1127 or its products might serve as biomarkers for specific resistant lineages

    • Antibodies against HI_1127 could enable rapid identification of H. influenzae in clinical samples

  • Vaccine Development:

    • If HI_1127 is surface-exposed and conserved, it could potentially serve as a vaccine antigen

    • Unlike the Hib vaccine that targets only type b strains, a protein-based vaccine could potentially protect against non-typeable strains that now represent 91.7% of isolates

  • Evolutionary Insights:

    • Understanding how HI_1127 varies across the highly admixed population structure of H. influenzae could reveal adaptation mechanisms

    • Evidence of negative selection affecting HI_1127 would suggest functional constraints that could be exploited therapeutically

What are the most promising future research directions for HI_1127?

Based on current understanding of H. influenzae biology and the challenges of studying uncharacterized proteins, several research directions show particular promise:

Research DirectionApproachPotential Impact
Structure-Function StudiesDetermine high-resolution structure and identify functional domainsFoundation for rational drug design, mechanistic understanding
Genetic Interaction MappingSynthetic genetic array analysis to identify functional networksContextual understanding, identification of backup pathways
In vivo SignificanceAnimal model studies of HI_1127 mutantsValidation of pathogenic relevance, pre-clinical therapeutic assessment
Comparative GenomicsAnalysis across >10,000 sequenced H. influenzae strainsEvolutionary insights, correlation with virulence and resistance
Host-Pathogen InteractionIdentification of host factors interacting with HI_1127Intervention points, host susceptibility factors
Population TranscriptomicsExpression analysis across diverse clinical isolatesRegulatory mechanisms, expression-phenotype correlations
Single-Cell TechnologiesAnalysis of HI_1127 expression at single-cell levelHeterogeneity insights, identification of bacterial subpopulations

These directions leverage cutting-edge technologies while addressing the clinical relevance of H. influenzae as an opportunistic pathogen with increasing antibiotic resistance challenges .

How can researchers overcome challenges in studying uncharacterized proteins like HI_1127?

Studying uncharacterized proteins presents unique challenges requiring strategic approaches:

  • Integrated Methodologies:

    • Combine computational predictions with experimental validation

    • Apply multiple complementary experimental techniques

    • Use both targeted and unbiased screening approaches

    • Integrate data across various biological scales (molecular to organismal)

  • Technological Solutions:

    • For membrane proteins: nanodiscs, lipid cubic phase crystallization

    • For structural determination: cryo-EM for membrane proteins

    • For interaction studies: proximity labeling in native conditions

    • For functional assessment: high-throughput phenotyping

  • Collaborative Approaches:

    • Form interdisciplinary teams combining computational and experimental expertise

    • Establish consortia focused on uncharacterized protein families

    • Develop shared resources and standardized protocols

    • Enable open data sharing to accelerate discovery

  • Strategic Prioritization:

    • Focus on proteins with evidence of biological significance

    • Select proteins with features suggesting tractability

    • Target proteins conserved across clinically relevant strains

    • Identify proteins with preliminary functional hints from omics data

  • Novel Frameworks:

    • Develop function prediction tools specific for uncharacterized proteins

    • Create ontologies and classification systems for partial characterization

    • Establish benchmarks for confidence in functional assignment

    • Implement machine learning approaches integrating diverse data types

By systematically addressing these challenges, researchers can accelerate the characterization of proteins like HI_1127, potentially revealing new biological mechanisms and therapeutic opportunities for addressing infectious diseases like those caused by H. influenzae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.