Recombinant Haemophilus influenzae Uncharacterized protein HI_1253 (HI_1253)

What is Haemophilus influenzae Uncharacterized protein HI_1253?

HI_1253 (UniProt ID: P44139) is an uncharacterized protein from Haemophilus influenzae consisting of 127 amino acids. It can be recombinantly expressed with an N-terminal His tag in E. coli systems for research purposes . The amino acid sequence suggests potential membrane association based on its hydrophobic regions, though its specific function remains to be elucidated.

What is the complete amino acid sequence of HI_1253?

The full amino acid sequence of HI_1253 is: MNFDRTFLTFLGVIMLVHLHIFFAFLSLALLVIRGAMQLNGKNWRSIKLLKILPHLSDTLLIVSGVVILYLFAFGIEWWLVAKFALLILYIVFAAKFFSKKVSQPKSIFFWLACVSFIGAMLIAYLK . This sequence can be analyzed using bioinformatics tools to predict structural features and potential functional domains.

What are the optimal storage and handling conditions for recombinant HI_1253?

Recombinant HI_1253 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . For short-term storage, working aliquots can be maintained at 4°C for up to one week. The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

What expression systems are suitable for recombinant HI_1253 production?

E. coli is the validated expression system for recombinant HI_1253 production, as indicated by commercial sources . For optimal expression, researchers should consider testing multiple E. coli strains optimized for membrane protein expression if HI_1253 proves difficult to express. The protein has been successfully expressed as a full-length construct (1-127 amino acids) with an N-terminal His tag .

What purification strategies are most effective for recombinant HI_1253?

Since recombinant HI_1253 contains an N-terminal His tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins represents the primary purification method . For membrane proteins like HI_1253, consider incorporating mild detergents during purification to maintain protein solubility. Quality control typically involves SDS-PAGE analysis, with commercial preparations achieving greater than 90% purity .

What functional assays are appropriate for studying an uncharacterized protein like HI_1253?

For initial characterization of HI_1253, researchers should consider:

• Subcellular localization studies to confirm membrane association

• Protein-protein interaction studies to identify binding partners

• Gene knockout or knockdown experiments to determine phenotypic effects

• Expression analysis during different growth conditions or infection stages

• Structural studies to identify potential functional domains

How should I design experiments to investigate potential roles of HI_1253 in H. influenzae pathogenesis?

When investigating HI_1253's role in pathogenesis, implement the following methodological approach:

These approaches should be conducted with appropriate controls, including empty vector controls, complementation controls, and testing under multiple relevant environmental conditions.

What controls are essential when studying HI_1253 function?

Essential controls include: (1) Empty vector controls for overexpression studies; (2) Complementation controls for knockout studies; (3) Inactive mutant versions as negative controls; (4) Multiple tag positions to account for potential functional interference; and (5) Testing under multiple environmental conditions relevant to H. influenzae's lifecycle to establish biological relevance.

How might HI_1253 relate to phase variation mechanisms in H. influenzae?

While direct evidence linking HI_1253 to phase variation is not available in the current literature, this possibility merits investigation given the importance of phase variation in H. influenzae pathoadaptation . Nontypeable H. influenzae (NTHi) utilizes phase variation in surface proteins like HMW adhesins to switch between phenotypes during chronic infection . Researchers should analyze the HI_1253 gene and promoter regions for simple sequence repeats (SSRs) that could mediate phase variation, similar to the mechanism observed with HMW1A where changes in SSR numbers affect protein expression levels .

What methods can determine if HI_1253 contributes to antimicrobial resistance?

To investigate potential roles in antimicrobial resistance:

• Generate knockout and overexpression strains for susceptibility testing

• Perform minimum inhibitory concentration (MIC) assays using standardized methods for H. influenzae, such as Haemophilus test medium (HTM)

• Test against multiple antibiotic classes, particularly β-lactams, which have documented resistance mechanisms in H. influenzae

• Consider the fastidious nature of H. influenzae when designing susceptibility tests, ensuring supplementation with required growth factors like NAD and an iron source

• Follow CLSI (Clinical and Laboratory Standards Institute) guidelines for interpretation of results, while being aware that many breakpoints for H. influenzae are microbiological rather than clinically relevant

How can membrane topology of HI_1253 be determined experimentally?

Given the likely membrane association of HI_1253, determining its topology is crucial for functional understanding. Recommended methodological approaches include:

• Cysteine scanning mutagenesis followed by accessibility assays

• Protease protection assays to determine exposed regions

• Fluorescence microscopy using GFP fusion constructs

• Site-directed spin labeling coupled with EPR spectroscopy

For structural studies, consider reconstitution in lipid nanodiscs or amphipols to provide a native-like membrane environment that may better preserve protein conformation.

How should I interpret discrepancies in functional assay results for HI_1253?

When confronting discrepant results in HI_1253 studies, consider the following factors:

• Experimental conditions (growth media, temperature, phase)

• Strain-specific genetic backgrounds and compensatory mechanisms

• Expression levels across experiments (overexpression artifacts)

• Impact of different tags or fusion constructs on protein function

• Potential post-translational modifications

Triangulation of methods often helps resolve apparent contradictions, and careful documentation of experimental conditions is essential for meaningful comparison between studies.

What bioinformatic approaches can predict HI_1253 function?

Multiple bioinformatic approaches can aid function prediction:

• Sequence homology analysis using BLAST against characterized proteins

• Domain prediction using tools like Pfam or InterPro

• Secondary structure and transmembrane domain prediction

• 3D structure prediction using AlphaFold2 or similar tools

• Genomic context analysis to identify co-regulated genes

• Comparative genomics across different Haemophilus strains

These approaches generate testable hypotheses about functional roles that can guide experimental design.

How does understanding HI_1253 contribute to H. influenzae pathogenesis knowledge?

Understanding HI_1253 may provide insights into H. influenzae pathogenesis mechanisms, particularly if it affects membrane properties or host-pathogen interactions. Like other phase-variable proteins in H. influenzae, HI_1253 could potentially contribute to bacterial adaptation during persistent infections, which are associated with disease progression in conditions like chronic obstructive pulmonary disease (COPD) . Determining its role could reveal novel virulence mechanisms or therapeutic targets.

How might HI_1253 research relate to lifestyle switching in chronic H. influenzae infections?

Research on NTHi has revealed a phase variation-controlled lifestyle switch during persistent infection, transitioning from high cellular invasiveness to biofilm formation . If HI_1253 participates in similar processes, it could be part of the bacterial adaptation mechanisms during chronic infection. Investigating its expression patterns in longitudinal clinical isolates, similar to studies conducted with HMW adhesins, might reveal patterns of adaptation associated with persistence.

What are the challenges in antimicrobial susceptibility testing that might affect HI_1253 functional studies?

When conducting antimicrobial susceptibility testing in the context of HI_1253 research, researchers should be aware of several methodological challenges specific to H. influenzae:

• The fastidious nature of H. influenzae requires specialized media with NAD and an iron source

• Multiple susceptibility testing media have been developed by different organizations, potentially leading to variations in results

• Interlaboratory differences in results can be more significant than differences between testing media

• Current CLSI interpretation guidelines state that results for certain antimicrobials "are often not useful for the management of individual patients" but may be appropriate for surveillance studies

• The distinction between microbiological breakpoints and clinically relevant breakpoints must be considered when interpreting results

These factors should be carefully considered when designing experiments to investigate potential roles of HI_1253 in antimicrobial resistance or susceptibility.