Recombinant Haemophilus influenzae Uncharacterized protein HI_1298 (HI_1298)

Shipped with Ice Packs
In Stock

Description

Overview of HI_1298

Recombinant Haemophilus influenzae Uncharacterized Protein HI_1298 (HI_1298) is a transmembrane protein derived from Haemophilus influenzae, a Gram-negative bacterium known for its role in respiratory infections. This protein is uncharacterized, meaning its specific biological function remains unidentified. It is expressed recombinantly in Escherichia coli and tagged with an N-terminal His-tag for purification purposes .

Key Features:

  • UniProt ID: P45146

  • Protein Length: Full-length (1-231 amino acids)

  • Expression System: E. coli

  • Tag: N-terminal His-tag

  • Form: Lyophilized powder

  • Purity: >90% as determined by SDS-PAGE .

Expression:

HI_1298 is expressed in E. coli using recombinant DNA technology. The His-tag facilitates purification via affinity chromatography .

Applications

HI_1298 is primarily used in research settings for:

  • Protein characterization studies.

  • Investigations into bacterial membrane proteins.

  • Development of potential therapeutic interventions targeting bacterial pathogens .

Potential Function:

While the exact function of HI_1298 remains unknown, uncharacterized proteins like this often play roles in bacterial survival, pathogenicity, or interaction with host cells. Further studies could reveal its involvement in processes such as nutrient transport or immune evasion.

Related Studies:

Research on other Haemophilus influenzae proteins has demonstrated their roles in adhesion, immune modulation, and enzymatic activity (e.g., phosphomonoesterase activity). These findings provide a framework for exploring HI_1298's function .

Data Table

FeatureDetails
UniProt IDP45146
Expression SystemE. coli
Protein LengthFull-length (1–231 amino acids)
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C
ApplicationsSDS-PAGE, protein characterization

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
HI_1298; Uncharacterized protein HI_1298
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1298
Target Protein Sequence
MQQYIIYLYTFLTIFGFWLALQISKRWKSMIFNTFVLTVLILAAILVIGKIPYDDYMAGN APINNLLGLSIVALALPLYEQLRQIARQWKIILSTVVIASFLAMLSGGLLALLLGSTPEM VATVLPKSITMPIAMEVSRHLGGIPAVTAVGVVVAGLQGSIFGYLVLKKLGVKHQEAIGL SVGSVSHALGTVSCMETNPTAGSYSSISLVLCGIISSILAPFVFKLIYFFV
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1298

STRING: 71421.HI1298

Protein Families
YohK (E.coli)/YwbG (IPA-22R) (B.subtilis) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the HI_1298 gene in Haemophilus influenzae?

The HI_1298 gene is located within the genome of Haemophilus influenzae, a Gram-negative human pathogen that primarily resides in the upper respiratory tract . The genomic context analysis reveals that HI_1298 is situated within a region potentially associated with bacterial surface proteins. Unlike characterized surface proteins such as Protein H (PH), which has been identified as a lipoprotein capable of binding factor H (FH), HI_1298 remains functionally uncharacterized . Comparative genomic analysis across multiple H. influenzae strains suggests conservation of this gene, indicating potential biological significance. The gene's nucleotide sequence and predicted amino acid composition provide preliminary insights for functional prediction and experimental design considerations.

How does HI_1298 compare structurally to other characterized proteins in Haemophilus influenzae?

Structural comparison between HI_1298 and characterized H. influenzae proteins reveals both similarities and distinct features. Unlike the well-characterized Protein H, which functions as a surface-exposed lipoprotein mediating interaction with human factor H (FH), HI_1298 has a different predicted structure . Bioinformatic analysis suggests HI_1298 contains potential transmembrane helices and conserved domains that differ from those found in Protein H. While Protein H variants from different H. influenzae strains share only 56% amino acid identity yet maintain similar FH-binding functionality, HI_1298's conserved motifs suggest a potentially different biological role . Structural prediction tools indicate potential for protein-protein interactions, though experimental validation is required to confirm these computational analyses.

What expression systems are suitable for recombinant production of HI_1298?

The expression of recombinant HI_1298 can be approached through several expression systems, each with distinct advantages based on research objectives. For fundamental characterization studies, an E. coli-based expression system offers efficient production, similar to the system successfully used for recombinant expression of Protein H variants from H. influenzae . For studies requiring native post-translational modifications, expression within H. influenzae itself using the recently developed pTBH toolkit (toolbox for Haemophilus) would be advantageous . This toolkit includes standardized modules with selectable markers, replication origins, and reporter genes that can be engineered for HI_1298 expression .

Expression SystemAdvantagesConsiderationsSuitable Applications
E. coliHigh yield, rapid growth, economicalMay lack proper folding/modificationsInitial characterization, structural studies
H. influenzae (pTBH toolkit)Native environment, proper modificationsLower yield, more complexFunctional studies, interaction assays
Cell-free systemsAvoids toxicity issues, rapidHigher cost, limited post-translational modificationsPreliminary function testing
Mammalian cellsHuman-like modificationsComplex, expensiveHost-pathogen interaction studies

What methodologies are most effective for determining the subcellular localization of HI_1298?

Determining the subcellular localization of HI_1298 requires a multi-faceted approach combining computational prediction with experimental validation. Computational analysis should begin with signal peptide prediction, transmembrane domain analysis, and subcellular localization algorithms. Experimentally, fluorescent protein tagging using the pTBH toolkit's reporter gene modules offers a powerful approach . This system includes six reporter genes for fluorescent or bioluminescent labeling that can be fused to HI_1298 and introduced into H. influenzae strains . Cell fractionation followed by Western blotting with anti-HI_1298 antibodies provides complementary biochemical validation.

For definitive localization, quantitative image analysis methods as described for H. influenzae studies can be employed . These include confocal microscopy with z-stack acquisition and 3D reconstruction to visualize protein distribution in relation to cellular compartments. For studies examining potential surface exposure, fluorescence-activated cell sorting (FACS) with antibodies against HI_1298 in non-permeabilized versus permeabilized cells can differentiate between surface and internal localization, similar to methodologies used for characterizing PH protein in H. influenzae .

How might HI_1298 contribute to H. influenzae pathogenesis based on comparative analysis with characterized virulence factors?

Based on comparative analysis with characterized virulence factors, HI_1298 could potentially contribute to H. influenzae pathogenesis through several mechanisms. H. influenzae employs various strategies to circumvent host innate immune responses, particularly the complement system . If HI_1298 shares functional characteristics with Protein H (PH), which has been identified as crucial for H. influenzae resistance against complement activation through factor H binding, it may contribute to immune evasion .

To investigate this hypothesis, experimental approaches should include:

  • Deletion mutagenesis of the HI_1298 gene to create knockout strains and assessment of virulence in appropriate models

  • Complementation studies to confirm phenotypic changes result from the specific gene deletion

  • Serum resistance assays comparing wild-type and ΔHI_1298 mutants, similar to those conducted for PH protein

  • Host-cell interaction studies examining adhesion, invasion, and intracellular survival capabilities

The potential role of HI_1298 in biofilm formation should also be investigated, given the importance of biofilms in H. influenzae pathogenesis. Mixed biofilm architecture studies utilizing differentially labeled strains (wild-type and ΔHI_1298) through the pTBH plasmid toolkit could reveal spatial organization changes and antibiotic susceptibility profiles .

What interaction partners of HI_1298 can be identified and how do they inform function?

Identifying interaction partners of HI_1298 requires systematic protein-protein interaction studies utilizing complementary approaches. Pull-down assays using recombinant HI_1298 as bait followed by mass spectrometry represent a primary approach. Additionally, bacterial two-hybrid systems can screen for interactions with both bacterial and host proteins.

For host-protein interactions, overlay assays with human serum or tissue extracts can reveal binding to specific host factors, similar to how Protein H was found to interact with factor H through specific short consensus repeats 7 and 18-20 . Surface plasmon resonance (SPR) or bio-layer interferometry provide quantitative binding kinetics for identified interactions.

Functional validation of interactions requires genetic approaches:

  • Site-directed mutagenesis of predicted interaction domains

  • Competition assays with purified domains

  • In vitro and cellular infection models examining the effect of disrupting identified interactions

A proximity-labeling approach using BioID or APEX2 fused to HI_1298 in the native H. influenzae environment provides an unbiased method to identify the protein's proximal interactome under physiologically relevant conditions.

What strategies can overcome challenges in expressing and purifying recombinant HI_1298?

Recombinant expression and purification of HI_1298 presents several challenges that can be addressed through strategic experimental design. Expression optimization should begin with codon optimization for the selected expression system, considering that H. influenzae has different codon usage patterns than common expression hosts like E. coli. Testing multiple fusion tag configurations (N-terminal, C-terminal, or cleavable tags) helps identify constructs that maintain protein solubility and function.

For purification challenges, the following strategies are recommended:

  • Solubility screening using different buffer conditions (pH, ionic strength, detergents)

  • Inclusion body recovery protocols if the protein forms aggregates

  • On-column refolding techniques for insoluble fractions

  • Size exclusion chromatography as a final polishing step to ensure homogeneity

When expression in E. coli proves challenging, alternative systems should be considered. The pTBH toolkit for H. influenzae offers a native environment for expression . This system includes two selectable markers and various replication origins assembled in modular combinations to create standardized and versatile plasmids, which can be adapted for recombinant HI_1298 expression .

How can researchers design functional assays to determine the biological role of HI_1298?

Designing functional assays for HI_1298 requires a hypothesis-driven approach based on bioinformatic predictions and comparative analysis with characterized H. influenzae proteins. Functional assays should address several key questions:

  • Is HI_1298 involved in bacterial adhesion to host cells?

    • Cell adhesion assays with wild-type versus ΔHI_1298 strains

    • Microscopy visualization using fluorescently labeled bacteria (via pTBH reporter constructs)

  • Does HI_1298 contribute to immune evasion?

    • Serum resistance assays comparing susceptibility to complement-mediated killing

    • Phagocytosis resistance quantification using differentiated THP-1 cells

  • Is HI_1298 involved in nutrient acquisition?

    • Growth curve analysis in nutrient-limited media

    • Functional complementation in auxotrophic bacterial strains

  • Does HI_1298 influence biofilm formation?

    • Static and flow cell biofilm assays

    • Quantitative image analysis of biofilm architecture using the pTBH toolkit's fluorescent reporters

A systematic approach combining these functional assays with protein interaction studies and localization data will converge to reveal the biological role of HI_1298.

What are the optimal conditions for studying HI_1298 in the context of host-pathogen interactions?

Studying HI_1298 in host-pathogen interactions requires careful consideration of experimental models and conditions that recapitulate key aspects of H. influenzae pathogenesis. Cell culture models should include respiratory epithelial cells (A549, BEAS-2B, or primary human bronchial epithelial cells) cultured under air-liquid interface conditions to better mimic the respiratory epithelium.

For infection studies, considerations include:

  • Bacterial preparation:

    • Growth phase standardization (mid-log phase generally optimal)

    • Medium composition affecting virulence gene expression

    • Use of fluorescently labeled strains via the pTBH toolkit for visualization

  • Infection parameters:

    • Multiplicity of infection (MOI) optimization

    • Infection duration based on study objectives

    • Co-infection models with other respiratory pathogens

  • Advanced imaging approaches:

    • Live-cell imaging to track intracellular trafficking

    • Quantitative image analysis methods as described for H. influenzae studies

    • Subcellular compartment markers to assess bacterial localization

For studying intracellular dynamics, the pTBH toolkit's fluorescent reporters enable visualization of bacteria within subcellular acidic compartments, allowing quantification of differential kinetics upon infection of cultured airway epithelial cells .

How should researchers analyze HI_1298 sequence conservation across H. influenzae strains?

Sequence conservation analysis of HI_1298 across H. influenzae strains requires systematic bioinformatic approaches. The analysis should begin with comprehensive sequence retrieval from multiple clinical and laboratory strains, followed by multiple sequence alignment using tools like MUSCLE or CLUSTAL. Phylogenetic tree construction helps visualize evolutionary relationships and potential functional divergence.

Key metrics to calculate include:

  • Percent identity and similarity matrices

  • Conservation scores for individual amino acid positions

  • dN/dS ratios to identify positions under selective pressure

  • Identification of strain-specific variations that may correlate with virulence

Analysis ComponentMethodsInterpretation Guidance
Sequence retrievalBLAST against H. influenzae genomesEnsure comprehensive strain representation
Multiple sequence alignmentMUSCLE, CLUSTAL OmegaExamine gap patterns and conservation blocks
Phylogenetic analysisMaximum likelihood, Bayesian inferenceCorrelate with strain pathogenicity data
Functional domain predictionInterPro, SMART, PfamCompare conservation within vs. between domains
Selection pressure analysisPAML, HyPhyIdentify positively selected sites

For comparison, consider that the Protein H (PH) variants from Hib and Hif share only 56% identical amino acids yet maintain similar FH-binding functionality through conserved interaction domains . This suggests functional conservation may exist despite sequence divergence in certain protein regions.

What statistical approaches are appropriate for analyzing HI_1298 knockout phenotypes in infection models?

Statistical analysis of HI_1298 knockout phenotypes requires rigorous experimental design and appropriate statistical methods. For infection models comparing wild-type and ΔHI_1298 strains, the following statistical approaches are recommended:

  • Power analysis:

    • Pre-determine sample size requirements

    • Account for biological variability in infection models

    • Consider effect sizes based on preliminary data

  • Appropriate statistical tests:

    • t-tests for single-parameter comparisons between two strains

    • ANOVA with post-hoc tests for multi-strain or multi-condition comparisons

    • Non-parametric alternatives when normality assumptions are violated

    • Repeated measures analyses for time-course experiments

  • Advanced analytical approaches:

    • Mixed-effects models for nested experimental designs

    • Survival analysis for persistence or clearance studies

    • Multivariate analyses for complex phenotypic datasets

When examining mixed biofilm architecture or co-infection dynamics using fluorescent reporter strains, quantitative image analysis methods as described for H. influenzae studies should be employed . These approaches can reveal spatial organization patterns and strain interactions that simple CFU counts might miss.

For all analyses, proper biological and technical replication is essential, with a minimum of three independent biological replicates recommended to account for strain-to-strain variability.

How can researchers interpret contradictory findings about HI_1298 function?

Interpreting contradictory findings about HI_1298 function requires systematic evaluation of methodological differences, strain variability, and experimental conditions. When faced with conflicting results, researchers should:

  • Evaluate methodological differences:

    • Expression systems used (E. coli vs. native H. influenzae)

    • Fusion tags that may affect protein function

    • Assay conditions and readouts

  • Consider strain-specific effects:

    • Compare genetic backgrounds of H. influenzae strains used

    • Assess potential compensatory mechanisms in different strains

    • Evaluate genomic context differences that may affect gene regulation

  • Integrate multiple lines of evidence:

    • Prioritize in vivo findings over in vitro results when available

    • Consider whether contradictions reflect different aspects of a multifunctional protein

    • Develop unifying hypotheses that explain seemingly contradictory observations

  • Design reconciliation experiments:

    • Side-by-side comparisons under identical conditions

    • Complementation studies with variants from different strains

    • Domain-specific mutations to isolate functional regions

The work on Protein H variants provides a useful precedent, where despite sharing only 56% identical amino acids, both Hib and Hif PH variants similarly interacted with FH through conserved binding sites . This demonstrates how proteins can maintain core functions despite substantial sequence divergence, potentially explaining some contradictory findings.

What are the most promising future research directions for understanding HI_1298 function?

The most promising future research directions for understanding HI_1298 function encompass multiple complementary approaches. Structure-function studies represent a primary avenue, where solving the three-dimensional structure of HI_1298 would provide critical insights into potential binding sites and functional domains. Parallel to this, comprehensive interaction mapping using techniques like crosslinking mass spectrometry and proximity labeling would identify biological partners.

In vivo studies using animal models of H. influenzae infection comparing wild-type and ΔHI_1298 strains would reveal the protein's contribution to virulence and colonization. The development of conditional expression systems for HI_1298 would allow temporal control of expression to study its role at different infection stages.

Advanced genetic approaches using the pTBH toolkit for creating reporter strains would enable real-time visualization of HI_1298 expression and localization during infection. These fluorescently labeled strains could be used in host-pathogen interaction studies to track bacterial dynamics within host cells and tissues.

Integration of these approaches with systems biology techniques, including transcriptomics and proteomics comparing wild-type and mutant strains, would place HI_1298 function within the broader context of H. influenzae biology and pathogenesis.

How can characterization of HI_1298 contribute to broader understanding of bacterial pathogenesis?

Characterization of HI_1298 has potential to contribute significantly to the broader understanding of bacterial pathogenesis through several mechanisms. If HI_1298 functions in immune evasion, similar to how Protein H mediates interaction with factor H to prevent complement activation , its study could reveal novel bacterial strategies for immune subversion.

The protein may represent a conserved but previously uncharacterized virulence mechanism, potentially shared across multiple respiratory pathogens. Understanding its function could reveal new paradigms in host-pathogen interactions, particularly in the context of respiratory infections.

From a translational perspective, characterization of HI_1298 may identify new targets for antimicrobial development or vaccine strategies. If the protein proves essential for virulence or persistence, it could represent a target for anti-virulence compounds that disarm rather than kill pathogens, potentially reducing selective pressure for resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.