Recombinant Haemophilus influenzae Uncharacterized protein HI_1456 (HI_1456)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HI_1456; Uncharacterized protein HI_1456
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1456
Target Protein Sequence
MFLMWALRLVYVLVSNGYFVKQLFARASIIGVALLLSACATVPMASVEESNTAKQFRSPE KGNSGLYIYRDSFIGKALKKDLYIDDKFIGESAPDVFFYKTIKAGEHKISTESEFSNSDL NIKTESGKNYFIRQYTKFGVFVGGANLEQVSEEEGKKAISKLNMAVSH
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1456

STRING: 71421.HI1456

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Haemophilus influenzae protein HI_1456?

HI_1456 is an uncharacterized protein from Haemophilus influenzae strain ATCC 51907/DSM 11121/KW20/Rd with 168 amino acids. The protein is identified in the genome with UniProt accession number P44203, but its specific function remains undetermined. Sequence analysis suggests it contains a signal peptide and potential transmembrane domains, indicating it may be membrane-associated or secreted . Like other uncharacterized proteins, HI_1456 is predicted to be expressed in the organism, but lacks definitive functional annotation, making it part of the approximately 11% of hypothetical proteins encoded in the H. influenzae genome .

How should I design a basic expression system for recombinant HI_1456?

For initial expression studies, an E. coli-based system using the T7 promoter is recommended, similar to the approach used for other H. influenzae proteins . The protocol should include:

  • PCR amplification of the HI_1456 gene excluding the native signal sequence

  • Cloning into an expression vector with an N-terminal tag (His-tag recommended)

  • Transformation into a compatible E. coli strain (BL21(DE3) or derivatives)

  • IPTG induction at reduced temperatures (18-25°C) to enhance solubility

  • Extraction under native conditions followed by affinity chromatography

The signal sequence should be replaced with a secretion signal sequence without lipid modification to improve purification yields, as demonstrated with H. influenzae lipoprotein e (P4) .

Expression ParameterRecommended ConditionRationale
Host strainE. coli BL21(DE3)Reduced protease activity
Induction temperature18-25°CEnhanced protein folding
IPTG concentration0.1-0.5 mMModerate induction rate
Harvest time4-6 hours post-inductionOptimal yield/solubility balance
Buffer systempH 7.4-8.0 phosphate bufferNear predicted pI for stability

What in silico approaches can effectively characterize HI_1456 function?

A comprehensive in silico characterization requires multiple computational approaches to predict HI_1456 function:

  • Conserved domain analysis using CDD, PFAM, and InterProScan

  • Subcellular localization prediction using PSORTb, CELLO, and SignalP

  • Comparative homology modeling against structurally characterized proteins

  • Molecular dynamics simulations to identify potential binding pockets

  • Protein-protein interaction network prediction using STRING and interolog mapping

Each approach provides complementary information that, when integrated, offers a more robust functional prediction. Additionally, comparative genomics across multiple H. influenzae strains can reveal evolutionary conservation patterns that suggest functional importance . These approaches have successfully annotated hypothetical proteins in multiple bacterial species and should be applied systematically to HI_1456.

How might HI_1456 contribute to immune evasion mechanisms?

Based on structural similarities with other H. influenzae surface proteins, HI_1456 may potentially contribute to immune evasion through several mechanisms:

  • Binding to host complement regulators like factor H, similar to protein H (PH), which enables bacterial resistance to complement-mediated killing

  • Phase variation regulation through genetic switching mechanisms that create heterogeneous bacterial populations with differential protein expression profiles

  • Structural mimicry of host proteins to avoid immune recognition

  • Modulation of host cell signaling pathways to suppress inflammatory responses

To investigate these possibilities, functional assays comparing wild-type strains with HI_1456 knockout mutants should be conducted, measuring survival rates in human serum, complement deposition levels, and interaction with purified complement components .

What experimental approaches can validate predicted HI_1456 binding partners?

To validate computationally predicted binding partners of HI_1456, implement a multi-method validation approach:

  • Co-immunoprecipitation (Co-IP) - Express tagged versions of HI_1456 and potential partners, perform pull-down experiments followed by Western blot or mass spectrometry.

  • Surface Plasmon Resonance (SPR) - Measure real-time binding kinetics between purified HI_1456 and predicted partners with the following experimental design:

ComponentExperimental ConditionControl Condition
Immobilized proteinPurified HI_1456Irrelevant H. influenzae protein
AnalytePredicted binding partnerBuffer only
Concentration range0.1-100 nMSame
Association time120 secondsSame
Dissociation time600 secondsSame
ReplicatesMinimum 3 technical repeatsSame
  • Bacterial two-hybrid system - For in vivo validation of interactions within a bacterial context.

  • Cross-linking mass spectrometry - To identify transient or weak interactions that might be missed by other techniques .

Each validation experiment must include appropriate negative controls using unrelated proteins and positive controls using known interacting protein pairs from H. influenzae.

How should I design expression constructs to maximize recombinant HI_1456 solubility?

To maximize solubility of recombinant HI_1456, consider these critical design elements:

  • Signal sequence modification: Replace the native signal sequence with a non-lipidated secretion signal or remove it entirely, as N-terminal lipid modifications can reduce purification efficiency .

  • Fusion partners: Test multiple solubility-enhancing tags:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

    • GST (glutathione S-transferase)

  • Expression construct design matrix:

Construct IDN-terminal TagCleavage SiteC-terminal TagVector Backbone
HI1456-C1His₆TEVNonepET28a
HI1456-C2MBPFactor XaHis₆pMAL-c5X
HI1456-C3SUMOSUMO proteaseHis₆pET SUMO
HI1456-C4ThioredoxinEnterokinaseNonepET32a
  • Codon optimization: Adjust codon usage for E. coli expression while preserving critical structural elements.

  • Domain mapping: Create truncated constructs based on predicted domain boundaries to identify stable protein fragments if full-length expression proves challenging .

Each construct should be tested under multiple expression conditions, with solubility assessed by SDS-PAGE analysis of the supernatant and pellet fractions after cell lysis.

What controls are essential for interpreting HI_1456 functional assays?

When designing functional assays for HI_1456, include these essential controls:

  • Genetic controls:

    • Clean HI_1456 knockout strain (ΔHI_1456)

    • Complemented knockout strain (ΔHI_1456::HI_1456)

    • Overexpression strain (HI_1456+)

  • Protein controls:

    • Heat-inactivated HI_1456 (structural integrity disrupted)

    • Site-directed mutants targeting predicted functional residues

    • Related characterized H. influenzae protein as positive control

  • Assay-specific controls:

    • For immune evasion: Factor H-binding protein (PH) as positive control

    • For phosphatase activity: P4 lipoprotein as reference

    • For phase variation studies: colonies with confirmed repeat number differences

  • Experimental design controls:

    • Biological replicates (minimum n=3)

    • Technical replicates (minimum n=3)

    • Time-course measurements to capture kinetic effects

A rigorous heat-shock survival assay, similar to that used for mod gene studies, can provide valuable functional insights if HI_1456 is suspected to influence stress responses .

How can I design experiments to determine HI_1456 subcellular localization?

To definitively determine HI_1456 subcellular localization, implement a multi-method approach with appropriate controls:

  • Computational prediction validation:

    • Compare predictions from multiple algorithms (PSORTb, CELLO, SignalP)

    • Analyze transmembrane topology predictions (TMHMM, Phobius)

  • Fluorescence microscopy:

    • Create HI_1456-GFP fusion constructs

    • Use membrane and compartment-specific dyes as counterstains

    • Employ super-resolution techniques for precise localization

  • Subcellular fractionation protocol:

FractionExtraction MethodMarker Protein Control
CytoplasmicOsmotic shockGlyceraldehyde-3-phosphate dehydrogenase
Inner membraneSarkosyl extractionNADH dehydrogenase
Outer membraneSodium carbonateOmpA
PeriplasmicChloroform extractionβ-lactamase
SecretedTCA precipitation of mediaKnown secreted factors
  • Protease accessibility assays: Treat intact cells with proteases to determine surface exposure.

  • Immunogold electron microscopy: Use anti-HI_1456 antibodies with gold-conjugated secondary antibodies for high-resolution localization .

Each method provides complementary evidence, and convergence across multiple approaches provides the strongest support for localization assignments.

How should I interpret conflicting bioinformatics predictions about HI_1456?

When facing conflicting bioinformatics predictions about HI_1456 function or properties:

  • Evaluate prediction confidence scores: Prioritize predictions with higher confidence metrics and more robust statistical support.

  • Consider algorithm limitations: Different prediction tools use different training datasets and algorithms, explaining some discrepancies.

  • Implementation of consensus approach:

Prediction CategoryTools to ConsiderConsensus Strategy
Subcellular localizationPSORTb, CELLO, SignalPMajority vote + weighted by confidence scores
Function predictionInterProScan, PFAM, BLASTIntegrate domain-based and homology-based predictions
Structural predictionI-TASSER, AlphaFold, SWISS-MODELCompare model quality scores (TM-score, QMEAN)
  • Evolutionary conservation analysis: Features conserved across multiple bacterial species have higher likelihood of functional significance.

  • Structural assessment: When predictions about function conflict, analyze predicted 3D structures for conserved binding pockets or functional motifs.

  • Experimental validation priority: Design experiments that can specifically distinguish between conflicting predictions, using positive controls for each predicted function .

Remember that bioinformatics predictions serve as hypotheses that require experimental validation, especially for uncharacterized proteins like HI_1456.

What statistical approaches should I use to analyze HI_1456 protein-protein interaction data?

When analyzing protein-protein interaction data involving HI_1456:

  • Signal-to-noise determination:

    • Calculate Z-factors for high-throughput interaction screens

    • Use Bland-Altman plots to assess agreement between replicate measurements

    • Implement appropriate background subtraction methods

  • Affinity measurements statistical analysis:

ParameterStatistical ApproachReporting Standard
KD (equilibrium dissociation constant)Non-linear regression with 95% CIReport mean ± SEM from ≥3 independent experiments
kon/koff ratesGlobal fitting with residual analysisInclude goodness-of-fit parameters (R²)
Thermodynamic parametersVan't Hoff analysis with error propagationReport ΔH, ΔS, ΔG with error estimates
  • Multiple testing correction: When screening multiple potential interactors, use Benjamini-Hochberg or similar procedure to control false discovery rate.

  • Network analysis approaches:

    • Calculate centrality measures if HI_1456 is part of a larger interaction network

    • Use permutation tests to evaluate network topology significance

    • Implement bootstrap resampling to assess confidence in network edges

  • Data visualization: Present data using concentration-response curves for quantitative interactions and heat maps for multiple interactor comparisons .

Proper statistical analysis ensures reliable interpretation of interaction data and facilitates comparison with other H. influenzae proteins.

How can CRISPR-Cas9 technology be optimized for studying HI_1456 function in H. influenzae?

To optimize CRISPR-Cas9 technology for HI_1456 functional studies:

  • Guide RNA design considerations:

    • Design multiple sgRNAs targeting different regions of HI_1456

    • Evaluate off-target effects using H. influenzae genome-specific prediction tools

    • Include PAM site analysis specific to the Cas9 variant being used

  • Delivery optimization:

    • Test electroporation parameters specifically optimized for H. influenzae

    • Consider natural transformation approaches leveraging H. influenzae competence

    • Evaluate transient vs. stable Cas9 expression systems

  • Genome editing strategies:

Editing ApproachApplicationAdvantage
Complete knockoutNull phenotype analysisEliminates all protein function
Domain-specific deletionStructure-function studiesMaintains partial protein activity
Point mutationsCatalytic residue identificationMinimal disruption to protein structure
CRISPRiConditional knockdownTunable expression reduction
  • Phenotypic screening approaches:

    • High-throughput screens for growth, morphology and stress resistance

    • Competitive fitness assays in relevant infection models

    • Transcriptomics to identify genes affected by HI_1456 knockout

  • Validation strategies:

    • Complementation with wild-type and mutant versions

    • Rescue experiments with recombinant protein

    • Whole-genome sequencing to confirm editing and check for compensatory mutations

CRISPR-based approaches should be integrated with traditional knockout methodologies for comprehensive functional characterization.

How can contradictory experimental results on HI_1456 function be resolved?

When faced with contradictory experimental results regarding HI_1456 function:

  • Systematic variable isolation:

    • Review experimental conditions (temperature, pH, media composition)

    • Analyze strain backgrounds for genetic differences

    • Evaluate protein preparation methods and storage conditions

  • Independent methodology application:

    • Apply orthogonal techniques to measure the same parameter

    • Use both in vitro and in vivo approaches where possible

    • Involve independent laboratories for critical experiments

  • Reconciliation experimental design:

HypothesisExperimental ApproachControlsExpected Outcome
Strain-specific effectsTest multiple H. influenzae isolatesInclude reference strainsFunction observed only in specific genetic backgrounds
Environmental dependenceVary culture conditions systematicallyPositive controls under each conditionFunction manifests only under specific conditions
Context-dependent activityTest in physiologically relevant modelsInclude appropriate tissue controlsFunction observed only in specific host environments
  • Phase variation considerations: Determine if HI_1456 expression is subject to phase variation, which could explain phenotypic heterogeneity in populations .

  • Meta-analysis approaches: When data permits, perform statistical meta-analysis of all available results with proper weighting by study quality and sample size.

Contradictions often reveal important biological insights about context-dependent protein functions and should be explored thoroughly rather than dismissed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.