Recombinant Haemophilus influenzae Uncharacterized protein HI_1498 (HI_1498)

What is Haemophilus influenzae Uncharacterized protein HI_1498?

HI_1498 is an uncharacterized protein from the Gram-negative bacterium Haemophilus influenzae, which belongs to the family Pasteurellaceae. This bacterium is known to cause bacteremia, pneumonia, and acute bacterial meningitis, particularly in infants. HI_1498 is one of many hypothetical proteins (HPs) identified in the H. influenzae genome that have not yet been fully functionally characterized at the biochemical and physiological level . The protein consists of 139 amino acids and is available as a recombinant protein with an N-terminal His tag, expressed in E. coli systems for research purposes .

What are the basic structural properties of HI_1498?

The full-length HI_1498 protein consists of 139 amino acids with the following sequence:
MWLAHSHYTLACESIRSPLCKLPARLGGRTMISEFWEFVRSNFGVISTLIAIFIGAFWLKLDSKYAKKHDLSQLADIARSHDNRLATLESKVENLPTAVDVERLKTLLTDVKGDTKATSRQVDAMSHQVGLLLEAKLKE

The protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE. It is stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Based on the amino acid sequence, computational analysis would be needed to predict secondary and tertiary structures, as this information is not explicitly provided in the search results.

How does HI_1498 fit into the context of hypothetical proteins in H. influenzae?

HI_1498 is one of 429 hypothetical proteins identified in the H. influenzae genome, which contains a total of 1,657 functional proteins. Through extensive annotation and computational analysis, researchers have been able to assign functions to many previously uncharacterized proteins with varying levels of confidence . The study of HPs like HI_1498 is crucial for completing our understanding of the H. influenzae proteome, potentially revealing new protein pathways and cascades. Precise annotation of HPs may also lead to the discovery of new potential drug targets, which is particularly important given the emergence of multi-drug resistant H. influenzae strains .

What experimental design considerations are important when studying HI_1498?

When designing experiments to study HI_1498, researchers should follow a systematic approach:

• Define your variables clearly: Identify independent variables (what you will manipulate) and dependent variables (what you will measure)

• Formulate a specific, testable hypothesis about HI_1498's function

• Design experimental treatments to manipulate your independent variable

• Determine how you will assign samples to groups (between-subjects or within-subjects design)

• Plan precise measurements of your dependent variable

What are the recommended reconstitution and storage protocols for recombinant HI_1498?

The reconstituted protein should be aliquoted before freezing to minimize degradation from repeated freeze-thaw cycles .

What computational approaches can be used to predict potential functions of HI_1498?

Several computational approaches can be employed to predict the function of hypothetical proteins like HI_1498:

• Sequence similarity searches using BLAST to identify related well-characterized homologues

• Multiple sequence alignment of homologues to identify structurally/functionally important positions

• Functional domain identification using databases like Pfam, PROSITE, and PRINTS

• Motif analysis using tools like InterProScan and MEME suite to detect common motifs among proteins with low sequence identities

• Protein-protein interaction prediction using STRING database to understand the protein's role in biological networks

Additionally, newer AI-based approaches like those similar to AlphaFold (which has revolutionized protein structure prediction) might help predict protein localization and function based on amino acid sequences .

How can researchers determine the cellular localization of HI_1498?

To determine the cellular localization of HI_1498, researchers can use a combination of computational prediction tools and experimental verification methods:

Computational prediction tools:

Experimental verification methods:

• Subcellular fractionation followed by Western blotting

• Immunofluorescence microscopy with antibodies against the His-tag

• Fusion with reporter proteins (like GFP) to track localization

• Proteomics analysis of different cellular compartments

The sequence of HI_1498 (MWLAHSHYTLACESIRSPLCKLPARLGGRTMISEFWEFVRSNFGVISTLIAIFIGAFWLK LDSKYAKKHDLSQLADIARSHDNRLATLESKVENLPTAVDVERLKTLLTDVKGDTKATSR QVDAMSHQVGLLLEAKLKE) contains regions suggestive of transmembrane domains, which should be confirmed using the tools mentioned above .

What strategies can be used to identify the potential function of HI_1498?

A multi-pronged approach is recommended for determining the function of an uncharacterized protein like HI_1498:

• Sequence-based analysis:

  • Homology detection using sensitive methods like HHpred

  • Domain and motif identification

  • Secondary structure prediction

• Structural analysis:

  • Experimental structure determination (X-ray crystallography, NMR)

  • Structure prediction using tools like AlphaFold

  • Structural comparison with proteins of known function

• Genomic context analysis:

  • Examining neighboring genes and operons

  • Analysis of conservation patterns across species

• Experimental functional assays:

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction studies

  • Biochemical assays based on predicted function classes (enzymatic, binding, etc.)

• Integration of multiple lines of evidence:

  • Combining computational predictions with experimental data

  • Using protein interaction networks to infer function

Recent studies have shown that HPs in H. influenzae can be categorized into various functional classes including enzymes, transporters, carriers, receptors, signal transducers, binding proteins, and virulence factors .

How do newer AI approaches enhance the functional annotation of proteins like HI_1498?

Recent advances in AI-based approaches have revolutionized protein analysis. Just as AlphaFold has transformed protein structure prediction from amino acid sequences, new machine learning models are being developed to predict protein localization and function:

• These models can detect subtle patterns in amino acid sequences that determine where proteins localize within cells

• They can identify regions of amino acids that do not fold into fixed structures but are important for helping proteins join dynamic compartments in the cell

• The models can predict a protein's localization to any dynamic compartment based on its sequence

• These tools complement existing methods like AlphaFold, creating a more comprehensive toolkit for protein analysis

For HI_1498, these AI approaches could help identify whether it localizes to specific cellular compartments, which would provide important clues about its potential function and role in H. influenzae pathogenesis.

How might HI_1498 contribute to H. influenzae pathogenesis?

Understanding the potential role of HI_1498 in H. influenzae pathogenesis requires considering several possibilities:

• Membrane association: If HI_1498 is confirmed to be a membrane protein as suggested by its sequence, it might be involved in:

  • Host-pathogen interactions

  • Adhesion to host cells

  • Resistance to host defense mechanisms

  • Transport of essential nutrients or export of virulence factors

• Virulence factor: Many previously uncharacterized proteins in pathogens have later been identified as virulence factors. HI_1498 could potentially be involved in:

  • Evasion of host immune responses

  • Biofilm formation

  • Toxin production or secretion

  • Regulation of other virulence genes

• Metabolic functions: HI_1498 might play a role in metabolic pathways critical for survival in the host environment:

  • Adaptation to nutrient-limited conditions

  • Response to oxidative stress

  • pH regulation

• Drug resistance: Given the emergence of multi-drug resistant H. influenzae strains, HI_1498 might contribute to:

  • Antibiotic efflux

  • Modification of drug targets

  • Enzymatic degradation of antimicrobials

Comparative genomic analyses across pathogenic and non-pathogenic strains could provide insights into whether HI_1498 is associated with virulence.

What challenges might researchers encounter when attempting to crystallize HI_1498 for structural studies?

Crystallizing membrane or membrane-associated proteins like HI_1498 presents several challenges:

• Hydrophobicity and solubility issues:

  • The protein sequence suggests membrane-associated regions, which can cause aggregation during purification

  • Detergent screening is often necessary to maintain protein solubility

  • Finding the right detergent-protein ratio is critical for crystal formation

• Protein stability considerations:

  • Recombinant expression might yield improperly folded protein

  • The His-tag might need to be cleaved for successful crystallization

  • Buffer optimization to maintain protein stability during concentration is essential

• Crystallization condition optimization:

  • Extensive screening of crystallization conditions is necessary

  • Additives might be required to promote crystal formation

  • Micro-crystallization techniques might be needed for difficult proteins

• Alternative approaches if crystallization fails:

  • Cryo-electron microscopy (cryo-EM)

  • Nuclear Magnetic Resonance (NMR) for structural determination

  • Computational structure prediction validated by experimental data

Researchers should consider starting with limited proteolysis experiments to identify stable domains that might crystallize more readily than the full-length protein.

How can researchers design mutational studies to probe the function of HI_1498?

Strategic mutational analysis can provide valuable insights into HI_1498's function:

• Selection of mutation targets:

  • Conserved amino acids identified through multiple sequence alignments

  • Predicted functional domains or motifs

  • Predicted transmembrane regions or protein-protein interaction sites

  • Potential active site residues based on structural predictions

• Types of mutations to consider:

  • Alanine scanning of conserved regions

  • Conservative vs. non-conservative substitutions

  • Truncation mutants to identify essential domains

  • Site-directed mutagenesis of predicted functional residues

• Functional assays for mutants:

  • In vitro biochemical assays based on predicted function

  • In vivo complementation studies in knockout strains

  • Protein-protein interaction assays to identify disrupted interactions

  • Localization studies to determine if mutations affect targeting

• Data analysis and interpretation:

  • Comparison of mutant phenotypes to wild-type

  • Correlation of structural changes with functional effects

  • Integration with other experimental data

A systematic mutational approach, combined with functional assays, can provide strong evidence for the protein's mechanistic role in the bacterium.

What are common issues when working with recombinant HI_1498 and how can they be addressed?

For the best results when working with HI_1498, researchers should adhere to the storage and handling recommendations: reconstitute in deionized sterile water, add 5-50% glycerol for storage, aliquot to avoid freeze-thaw cycles, and store working aliquots at 4°C for up to one week .

How can researchers validate putative functions assigned to HI_1498 through computational methods?

Computational predictions of protein function should always be experimentally validated:

• Biochemical validation:

  • Design assays based on predicted enzymatic activity

  • Test for predicted binding partners or substrates

  • Assess predicted physicochemical properties

• Genetic validation:

  • Create gene knockout or knockdown strains

  • Perform complementation studies

  • Analyze phenotypic changes in mutant strains

• Structural validation:

  • Confirm predicted structural features experimentally

  • Validate predicted binding sites through mutation

  • Use structural biology techniques to verify computational models

• Systems-level validation:

  • Transcriptomic analysis to identify co-regulated genes

  • Proteomic analysis to identify interaction partners

  • Metabolomic analysis to identify affected pathways

• Cross-species validation:

  • Test if orthologs in related species have similar functions

  • Compare phenotypes across species with gene modifications

By combining multiple validation approaches, researchers can build a stronger case for the assigned function and minimize the risk of misannotation based solely on computational predictions .

What are promising future research directions for understanding HI_1498?

Future research on HI_1498 should focus on:

• Comprehensive functional characterization:

  • Determination of three-dimensional structure

  • Identification of interaction partners

  • Elucidation of biochemical activity

• Role in pathogenesis:

  • Investigation of expression patterns during infection

  • Assessment of contribution to virulence in animal models

  • Evaluation as a potential therapeutic target

• Application of emerging technologies:

  • Use of advanced AI models for more accurate function prediction

  • CRISPR-based functional genomics approaches

  • Single-cell analysis of expression patterns during infection

• Comparative studies:

  • Analysis of conservation and variation across Haemophilus strains

  • Comparison with homologs in other pathogenic bacteria

  • Evolution of this protein family across bacterial species