Recombinant Haemophilus influenzae Uncharacterized protein HI_1560 (HI_1560)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Haemophilus influenzae Uncharacterized Protein HI_1560 (HI_1560) is a protein derived from the bacterium Haemophilus influenzae. It is produced using recombinant DNA technology, where the gene encoding HI_1560 is expressed in a host organism like E. coli . The HI_1560 protein is tagged with a His-tag to facilitate purification . The protein's function is currently uncharacterized, which means its specific biological role remains unknown .

Table 1: Basic Information of Recombinant HI_1560 Protein

AttributeDescription
SpeciesHaemophilus influenzae
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-156 amino acids)
FormLyophilized powder
UniProt AccessionP44253

Production and Structure

Recombinant HI_1560 is produced in E. coli as a full-length protein consisting of 156 amino acids . The use of E. coli as a host organism allows for efficient and cost-effective production of the protein . After expression, the protein is purified using its His-tag, which binds to affinity chromatography resins . The purified protein is then typically lyophilized into powder form for stability and ease of storage .

It shares some structural homology with folds associated with RNA binding, suggesting a possible role in binding distal nucleic acid sites .

Function and Interactions

As an uncharacterized protein, the precise function of HI_1560 in Haemophilus influenzae is not yet known . Bioinformatic analyses and experimental studies such as two-hybrid assays, co-immunoprecipitation, and pull-down assays can help identify its interacting partners .

Table 2: Potential Functions and Interacting Proteins

CategoryDetails
Biochemical FunctionUnknown; further studies are needed to elucidate its function
Interacting ProteinsIdentified through methods like yeast two-hybrid, co-IP, and pull-down assays; specific proteins not listed

Potential Role in Vaccine Development

Some research suggests the potential of Haemophilus influenzae proteins like P4 and OMP26 as vaccine components . While HI_1560 itself is not explicitly mentioned as a vaccine candidate, other proteins from Haemophilus influenzae have been investigated for their ability to induce protective immune responses . For example, intranasal immunization with recombinant P4 protein has been shown to induce specific mucosal immune responses and confer protection against Haemophilus influenzae infections in mice . Additionally, lipidated versions of recombinant OMP26 have been explored as vaccines to prevent Haemophilus influenzae infections .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
HI_1560; Uncharacterized protein HI_1560
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1560
Target Protein Sequence
MSFLTLKGNKMIIENQKDAEFSSAFKPSQLAQASRFKRWLASMINGLVLWVMAGLGFALG DFAGVVGMIVYAGFQLYFMKTYGQTMAKRWLGLRVFNYHTNQPVEFGKYIGREIIDILLA WTSFLLIISGIVALVRDDRRSLTDLVAGTIVLKDEK
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1560

STRING: 71421.HI1560

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Haemophilus influenzae Uncharacterized protein HI_1560?

Haemophilus influenzae Uncharacterized protein HI_1560 (UniProt ID: P44253) is a 156-amino acid protein derived from the pathogenic bacterium Haemophilus influenzae. This protein remains functionally uncharacterized, meaning its precise biological role has not been fully elucidated. The protein is available as a recombinant product expressed in E. coli systems with an N-terminal His-tag to facilitate purification and detection . As a component of H. influenzae, a Gram-negative, facultatively anaerobic pathogenic bacterium belonging to the Pasteurellaceae family, HI_1560 may play roles in bacterial physiology or pathogenesis that warrant further investigation.

How does sequence analysis inform potential functions of HI_1560?

Sequence analysis can provide preliminary insights into potential functions through several approaches:

  • Transmembrane domain prediction: The presence of hydrophobic regions (e.g., "LVLWVMAGLGFALG") suggests membrane association.

  • Conserved domain searches: Identifying known functional domains within the sequence.

  • Homology comparisons: Finding related proteins with characterized functions.

  • Secondary structure prediction: Identifying structural motifs that correlate with specific functions.

  • Evolutionary analysis: Determining conservation patterns across species.

While bioinformatic approaches provide hypotheses, experimental validation remains essential for confirming the actual function of this uncharacterized protein.

What are the key considerations when designing experiments to study HI_1560 function?

When designing experiments to investigate HI_1560 function, researchers should consider several critical factors:

  • Hypothesis formulation: Develop testable hypotheses based on sequence predictions and evolutionary relationships.

  • Control selection: Include appropriate positive and negative controls, particularly when testing for specific functions.

  • Randomization and blinding: Implement these to reduce bias, especially in phenotypic studies.

  • Statistical power: Ensure sufficient replication to detect significant effects .

  • Variable isolation: Use experimental designs like randomized blocks to control for confounding factors .

  • Complementary methodologies: Employ multiple techniques to cross-validate findings.

  • Physiological relevance: Design conditions that reflect the native bacterial environment.

Research designs should follow systematic approaches, such as the Solomon four-group design or randomized block design when appropriate, to control for extraneous variables and strengthen causal inferences .

How should I design experiments to study HI_1560 expression under different conditions?

Designing experiments to study HI_1560 expression under different conditions requires a systematic approach:

  • Define experimental variables:

    • Independent variables: Temperature, pH, nutrient availability, growth phase, oxygen levels

    • Dependent variables: Expression level, solubility, localization, activity

  • Design structure:

    • Consider factorial designs to evaluate interaction effects between variables

    • Implement time-course analyses to capture dynamic responses

    • Use randomized block designs to control for batch effects

  • Expression measurement methods:

    • qRT-PCR for transcript levels

    • Western blotting with anti-His antibodies for protein detection

    • Mass spectrometry for absolute quantification

  • Statistical approach:

    • ANOVA for multi-factorial designs

    • Appropriate post-hoc tests for specific comparisons

    • Analysis of covariance (ANCOVA) to control for pre-existing differences

A sample experimental design matrix is provided in Table 1.

Table 1: Experimental Design Matrix for HI_1560 Expression Studies

Temperature (°C)Oxygen LevelGrowth Phase (OD600)Replicate SamplesMeasurement Methods
18Aerobic0.53qRT-PCR, Western blot
18Aerobic1.03qRT-PCR, Western blot
18Microaerobic0.53qRT-PCR, Western blot
18Microaerobic1.03qRT-PCR, Western blot
30Aerobic0.53qRT-PCR, Western blot
30Aerobic1.03qRT-PCR, Western blot
30Microaerobic0.53qRT-PCR, Western blot
30Microaerobic1.03qRT-PCR, Western blot
37Aerobic0.53qRT-PCR, Western blot
37Aerobic1.03qRT-PCR, Western blot
37Microaerobic0.53qRT-PCR, Western blot
37Microaerobic1.03qRT-PCR, Western blot

How can I handle contradictory data regarding HI_1560 function?

When encountering contradictory data regarding HI_1560 function, follow these methodological steps:

As noted in research methodology literature, "Unexpected findings can lead to new discoveries and avenues for further investigation" . Contradictory results should be viewed as opportunities for deeper understanding rather than failures.

What expression systems are most suitable for producing recombinant HI_1560?

Several expression systems can be employed for producing recombinant HI_1560, each with distinct advantages:

  • Bacterial systems:

    • E. coli BL21(DE3): Standard system with high yield potential

    • E. coli C41/C43: Specialized for membrane or toxic proteins

    • E. coli Origami: Enhanced disulfide bond formation

  • Yeast systems:

    • Pichia pastoris: Suitable for secreted or membrane proteins

    • Saccharomyces cerevisiae: Provides eukaryotic processing capabilities

  • Insect cell systems:

    • Baculovirus expression: Superior folding for complex proteins

  • Mammalian cell systems:

    • HEK293, CHO cells: For proteins requiring mammalian post-translational modifications

While E. coli remains the most commonly used system for HI_1560 expression , selection should be guided by protein characteristics and experimental requirements. Predictive approaches using computational tools can help guide optimal expression system selection to improve solubility and yield .

What are the optimal conditions for expressing soluble HI_1560 in E. coli?

Optimizing conditions for soluble HI_1560 expression in E. coli requires systematic parameter adjustment:

  • Temperature optimization:

    • Lower temperatures (18-25°C) often increase solubility by slowing expression rate

    • Compare expression at 37°C, 30°C, and 18°C after induction

  • Induction parameters:

    • IPTG concentration: 0.2 mM is recommended for HI_1560

    • Induction at OD600 of 0.5-0.7 shows good results

    • Duration of expression (4h vs. overnight)

  • Media selection:

    • LB broth with 100 μg/ml ampicillin is standard

    • Consider auto-induction media for higher yields

    • Supplementation with glycerol or glucose may improve folding

  • Host strain selection:

    • BL21(DE3) for standard expression

    • Rosetta strains for rare codon usage

    • ArcticExpress for cold-temperature expression enhancement

Table 2 summarizes expression conditions that have demonstrated success for HI_1560 production.

Table 2: Optimal Expression Conditions for Soluble HI_1560 in E. coli

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3)Standard expression strain
Growth mediaLB with 100 μg/ml ampicillinStandard rich media
Induction OD6000.5-0.7Mid-log phase for optimal induction
IPTG concentration0.2 mMLower concentrations may reduce inclusion body formation
Post-induction temperature18°CReduced temperature improves folding
Expression duration20 hoursExtended time at lower temperature
Shaking speed220 rpmEnsures proper aeration

How can I optimize the purification protocol for His-tagged HI_1560?

Optimizing the purification of His-tagged HI_1560 requires attention to several key factors:

  • Sample preparation:

    • Proper cell lysis (sonication or French press)

    • Clearing lysate by high-speed centrifugation

    • Filtration through 0.22 μm filters

  • Immobilized Metal Affinity Chromatography (IMAC) conditions:

    • Buffer optimization: Tris/PBS-based buffer, pH 8.0

    • Imidazole concentration in wash buffers (20-50 mM)

    • Elution strategy (gradient vs. step elution)

  • Additional purification steps:

    • Size exclusion chromatography to separate aggregates

    • Ion exchange chromatography for higher purity

    • Endotoxin removal for downstream applications

  • Storage conditions:

    • Adding 6% trehalose as a stabilizer

    • Aliquoting to avoid freeze-thaw cycles

    • Storage at -20°C/-80°C

  • Quality control:

    • SDS-PAGE to assess purity (>90% recommended)

    • Western blotting for identity confirmation

    • Mass spectrometry for absolute identification

For reconstitution of lyophilized protein, dissolve in deionized sterile water to 0.1-1.0 mg/mL and add glycerol (5-50% final concentration) before aliquoting for long-term storage .

What techniques can be used to characterize the structure of HI_1560?

Structural characterization of HI_1560 can be approached using multiple complementary techniques:

  • X-ray crystallography:

    • Provides atomic-resolution structures

    • Requires growing protein crystals

    • Optimization of crystallization conditions

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Yields solution structure information

    • Particularly useful for smaller proteins (<30 kDa)

    • Provides dynamics information

  • Cryo-electron microscopy:

    • Especially useful for membrane proteins

    • Does not require crystallization

    • Can visualize different conformational states

  • Circular Dichroism (CD) spectroscopy:

    • Estimates secondary structure content

    • Monitors thermal stability

    • Detects conformational changes upon ligand binding

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps solvent accessibility

    • Identifies dynamic regions

    • Detects conformational changes

  • Small-Angle X-ray Scattering (SAXS):

    • Provides low-resolution envelope structures

    • Works in solution

    • Complements high-resolution techniques

These approaches can be used in combination to build a comprehensive structural model of HI_1560.

How can I investigate potential binding partners of HI_1560?

Investigating potential binding partners of HI_1560 requires a multi-faceted approach:

  • Affinity-based methods:

    • Pull-down assays using His-tagged HI_1560

    • Co-immunoprecipitation with anti-His antibodies

    • Crosslinking coupled with mass spectrometry

  • Library screening approaches:

    • Yeast two-hybrid screening

    • Phage display

    • Protein microarrays

  • Biophysical interaction analyses:

    • Surface Plasmon Resonance (SPR)

    • Isothermal Titration Calorimetry (ITC)

    • Microscale Thermophoresis (MST)

  • In vivo approaches:

    • Bacterial two-hybrid systems

    • Proximity labeling (BioID, APEX)

    • Fluorescence Resonance Energy Transfer (FRET)

  • Computational predictions:

    • Protein-protein docking simulations

    • Sequence-based interaction predictions

    • Network analysis based on genomic context

Integration of multiple methods provides the strongest evidence for genuine protein-protein interactions, with experimental validation as the gold standard.

What experimental approaches can determine the potential role of HI_1560 in pathogenicity?

To investigate HI_1560's potential role in pathogenicity, consider these experimental approaches:

  • Genetic manipulation studies:

    • Gene knockout using CRISPR-Cas or traditional methods

    • Conditional expression systems

    • Complementation studies to confirm phenotypes

  • Virulence assays:

    • Adhesion to human cell lines

    • Biofilm formation capacity

    • Resistance to host defense mechanisms

  • Host interaction studies:

    • Immune response profiling (cytokine induction)

    • Host cell signaling pathway activation

    • Intracellular survival and replication

  • Animal infection models:

    • Factorial design with randomized blocks to control for animal variability

    • Comparison of wild-type vs. HI_1560 mutant strains

    • Measurement of bacterial load, host response, and disease progression

  • Omics approaches:

    • Transcriptomics to identify regulated genes

    • Proteomics to detect protein expression changes

    • Metabolomics to observe metabolic alterations

These approaches can be integrated within experimental designs like randomized block designs to control for host factors and other variables that might confound results .

How can I apply optimization approaches to experimental design for HI_1560 research?

Applying optimization approaches to experimental design for HI_1560 research involves:

  • Factorial design implementation:

    • Systematically vary multiple factors simultaneously

    • Identify interaction effects between variables

    • Reduce experimental runs while maximizing information

  • Response surface methodology:

    • Map relationships between multiple experimental factors

    • Find optimal conditions for expression or activity

    • Model complex biological responses

  • Design of Experiments (DoE) approaches:

    • Screening designs to identify significant factors

    • Optimization designs to fine-tune conditions

    • Robust designs to minimize variability

  • Statistical power optimization:

    • A priori sample size calculations

    • Sequential analysis approaches

    • Adaptive designs that adjust based on interim results

  • Causal inference optimization:

    • Randomization procedures to strengthen causal claims

    • Instrumental variable approaches when randomization isn't possible

    • Matching methods to control for confounders

As noted in recent research, "The study of experimental design offers tremendous benefits for answering causal questions across a wide range of applications... experimenters have started to examine such efficiency questions from an optimization perspective" . These approaches can significantly improve the efficiency and validity of HI_1560 research.

How should I address low expression yields of recombinant HI_1560?

When facing low expression yields of recombinant HI_1560, systematic troubleshooting is essential:

  • Expression system evaluation:

    • Try alternative E. coli strains optimized for membrane proteins

    • Consider codon optimization for E. coli

    • Test different promoter strengths

  • Growth condition optimization:

    • Screen multiple temperatures (18°C, 25°C, 30°C, 37°C)

    • Adjust media composition (LB, TB, minimal media)

    • Optimize induction timing and inducer concentration

  • Vector design improvements:

    • Test alternative fusion tags (MBP, GST, SUMO)

    • Optimize the position of the His-tag (N- vs. C-terminal)

    • Consider a dual tag approach

  • Toxic protein strategies:

    • Use tightly controlled expression systems

    • Co-express with chaperones

    • Add stabilizing agents to the growth media

  • Experimental design approach:

    • Implement factorial designs to identify optimal conditions

    • Use statistical tools to analyze interaction effects

    • Apply response surface methodology for optimization

For membrane proteins like HI_1560, specialized approaches such as using C41/C43 E. coli strains may be particularly effective.

What methods can be used when standard protein purification approaches fail for HI_1560?

When standard purification methods fail for HI_1560, consider these alternative approaches:

  • Tag alternatives:

    • Switch from His-tag to other affinity tags (Strep-tag, FLAG, GST)

    • Dual tagging strategies (His + another tag)

    • Tag position optimization (N- vs. C-terminal)

  • Alternative chromatography methods:

    • Hydrophobic interaction chromatography

    • Ion exchange chromatography

    • Hydroxyapatite chromatography

  • Membrane protein-specific strategies:

    • Detergent screening (DDM, CHAPS, OG)

    • Amphipol stabilization

    • Nanodiscs or liposome reconstitution

  • Non-chromatographic methods:

    • Ammonium sulfate precipitation

    • Polyethylene glycol fractionation

    • Aqueous two-phase extraction

  • On-column refolding:

    • Immobilize denatured protein on column

    • Gradually remove denaturant

    • Add folding enhancers during elution

Each alternative should be tested systematically, with appropriate controls and quality assessments to ensure the structural and functional integrity of the purified protein.

How can computational approaches predict HI_1560 function?

Computational approaches to predict HI_1560 function include:

  • Sequence-based prediction methods:

    • Hidden Markov Models for domain identification

    • Machine learning algorithms trained on characterized proteins

    • Evolutionary conservation mapping

  • Structure-based approaches:

    • Homology modeling using related proteins

    • Ab initio structure prediction

    • Active site prediction and comparison

  • Systems biology integration:

    • Gene neighborhood analysis

    • Protein-protein interaction network inference

    • Pathway enrichment analysis

  • Advanced computational tools:

    • AlphaFold2 for structure prediction

    • Molecular dynamics simulations

    • Binding site prediction algorithms

Recent advances in predictive approaches have "allowed the re-design of recombinant targets with increased expression and/or solubility" , making these computational methods increasingly valuable for uncharacterized proteins like HI_1560.

What opportunities exist for applying HI_1560 research to vaccine development?

Research on HI_1560 can contribute to vaccine development through several avenues:

  • Antigenicity assessment:

    • Epitope mapping experiments

    • B-cell epitope prediction

    • T-cell epitope identification

  • Conservation analysis:

    • Sequence comparison across H. influenzae strains

    • Population genomics to assess variability

    • Identification of conserved immunogenic regions

  • Structural vaccinology:

    • Structure-based epitope design

    • Stabilization of antigenic conformations

    • Rational immunogen engineering

  • Functional role evaluation:

    • Virulence contribution assessment

    • Host-pathogen interaction studies

    • Essentiality determination

  • Production optimization:

    • High-yield expression systems

    • Purification protocol development

    • Stability enhancement

H. influenzae has historically been an important target for vaccine development, with effective vaccines available for H. influenzae type B since the early 1990s . Research on previously uncharacterized proteins like HI_1560 may reveal new targets for next-generation vaccines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.