Recombinant Haemophilus influenzae Uncharacterized protein HI_1594 (HI_1594)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Haemophilus influenzae Uncharacterized Protein HI_1594 (HI_1594) is a protein derived from the bacterium Haemophilus influenzae . HI_1594 is considered an uncharacterized protein, meaning its specific function has not been definitively determined through experimentation .

Basic Characteristics:

  • Source: Haemophilus influenzae

  • Expression Host: E. coli

  • Protein Length: Full Length (1-223 amino acids)

  • Molecular Weight: The molecular weight will depend on post-translational modifications, which is not mentioned in the search results.

  • Tag: His-tagged

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Form: Lyophilized powder

  • Storage: Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles

  • Synonyms: HI_1594, Uncharacterized protein HI_1594

  • UniProt ID: P44265

Production and Sourcing

Recombinant HI_1594 is produced in E. coli and is available with an N-terminal His tag to facilitate purification . Recombinant proteins are often used in research due to their ease of production and purification .

Table: Recombinant HI_1594 Product Details

AttributeDescription
Catalog NumberRFL9376HF
SourceE. coli
SpeciesHaemophilus influenzae
TagHis tag
Protein LengthFull Length (1-223 aa)
Purity>90% by SDS-PAGE
ApplicationsSDS-PAGE
Storage ConditionsStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) for long-term storage at -20℃/-80℃. The default final concentration of glycerol is 50% .

Potential Functions and Interactions

Although HI_1594 is currently annotated as an uncharacterized protein, bioinformatics analyses can provide clues regarding its potential functions and interactions . HI_1594 is predicted to participate in various pathways and interact with different proteins and molecules . These interactions are detected through methods such as yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays . Further experimental studies are required to validate these predicted functions and interactions .

Table: Predicted Functions and Interactions

CategoryDescription
PathwayInvolved in several pathways (details not specified)
Protein FunctionHas several biochemical functions, some cooperated with other proteins, some acted by HI_1594 itself (details not specified)
Interacting ProteinsInteracts directly with proteins and molecules (interactions detected by yeast two hybrid, co-IP, pull-down, etc.) (details not specified)

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its use in production.
Synonyms
HI_1594; Uncharacterized protein HI_1594
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1594
Target Protein Sequence
MLIIGLCVVSMLLLSSNTFYLSGGVLGGSLVVNWFYPVLGKFGSILIGFVLALIGFIFCS GTSLIRLIVTFYHWLTMKNEQSENAEQEKSTEELEQIVIVKSDRSETENLDQNYLNVEQN SEIETVKPSLEAENISIGKSSSHLINISGLNPEVSIKSEYELANEENEKPQFSFGFDSES LPSVNLSSDSDEQRVSKNDFVAVWNKPVKTVVQEDLAIKSKCG
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Haemophilus influenzae uncharacterized protein HI_1594 and why is it significant in research?

    HI_1594 is a hypothetical protein from Haemophilus influenzae, a bacterium that colonizes the human respiratory tract and can cause various infections ranging from mild ear infections to serious invasive diseases like meningitis and bloodstream infections . As an uncharacterized protein, HI_1594's function has not been experimentally verified, but it is predicted to be expressed based on its open reading frame in the H. influenzae genome.

    The significance of studying HI_1594 lies in understanding its potential role in H. influenzae pathogenicity. Despite the success of the Hib vaccine, nontypeable H. influenzae (NTHi) remains a significant public health burden with increasing reports of multi-drug resistance . Characterizing previously unknown proteins could reveal new virulence factors and potential therapeutic targets.

  • What expression systems are most effective for recombinant production of HI_1594?

    Based on successful development of expression systems for other H. influenzae proteins, two main expression systems have proven effective :

    Expression SystemAdvantagesDisadvantagesOptimization Parameters
    Escherichia coliHigh yield, simple cultivation, cost-effective, well-established protocolsPotential for inclusion body formation, lack of post-translational modificationsTemperature (15-37°C), inducer concentration, induction time, fusion tags
    Pichia pastorisProper protein folding, some post-translational modifications, high-density cultivationLonger production time, more complex media requirementsMethanol induction optimization, pH control, oxygen transfer rate

    For HI_1594, a systematic approach involves:

    • Codon optimization for the chosen expression host

    • Testing multiple vector systems with different promoters and fusion tags

    • Optimizing growth conditions and induction parameters

    • Developing a protein-specific purification strategy using affinity chromatography followed by polishing steps

  • What verification methods confirm the identity and purity of recombinant HI_1594?

    A multi-method verification approach is essential for confirming the identity of purified recombinant HI_1594:

    • SDS-PAGE analysis: Confirms the expected molecular weight and initial purity assessment

    • Western blotting: Using antibodies against fusion tags or the protein itself

    • Mass spectrometry: For definitive protein identification through:

      • Peptide mass fingerprinting (PMF)

      • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) with coverage analysis

    • N-terminal sequencing: Confirms the first 5-10 amino acids, verifying correct translation initiation

    • Size exclusion chromatography: Assesses protein homogeneity and oligomerization state

    • Dynamic light scattering: Provides information on size distribution and potential aggregation

    The combination of these methods provides comprehensive verification of the protein's identity, purity, and quality before proceeding with functional studies .

  • How should recombinant HI_1594 samples be properly stored to maintain stability?

    Since the specific properties of HI_1594 are not yet fully characterized, a systematic approach to storage optimization should be followed:

    Storage DurationRecommended ConditionsAdditional Considerations
    Short-term (1-2 weeks)4°C in stabilizing buffer with protease inhibitorsMonitor for degradation via SDS-PAGE
    Medium-term (months)-20°C in buffer containing 20-50% glycerolAliquot to minimize freeze-thaw cycles
    Long-term (years)-80°C as aliquots or lyophilized powderValidate recovery of activity after storage

    Buffer optimization is critical and should include systematic testing of:

    • pH range (typically 6.5-8.5)

    • Salt concentration (100-300 mM NaCl)

    • Buffer type (phosphate, Tris, HEPES)

    • Stabilizing additives (glycerol, reducing agents, specific ligands)

    Stability should be monitored through activity assays (once established) and structural integrity assessments using circular dichroism or fluorescence spectroscopy .

Advanced Research Questions

  • What experimental design is optimal for elucidating the function of uncharacterized protein HI_1594?

    Based on established principles of experimental design , a comprehensive approach for HI_1594 functional characterization should include:

    a) Define variables clearly:

    • Independent variables: Different experimental conditions, mutations, interaction partners

    • Dependent variables: Measurable outcomes (binding affinity, enzymatic activity, bacterial phenotypes)

    b) Formulate specific hypotheses based on bioinformatic predictions about HI_1594 function

    c) Design a multi-faceted experimental approach:

    • Bioinformatic analysis: Sequence similarity networks, structural predictions, genomic context analysis

    • Genetic approaches: Gene knockout or knockdown studies, complementation analysis

    • Biochemical characterization: Purified protein activity assays, interaction studies

    • Structural studies: X-ray crystallography, NMR, or cryo-EM

    d) Implement proper controls:

    • Positive controls with known function

    • Negative controls (empty vector, inactive mutants)

    • Validation using multiple methods

    • Biological and technical replicates

    e) Statistical design considerations:

    • Power analysis to determine sample size

    • Randomization and blinding where applicable

    • Appropriate statistical tests for hypothesis testing

  • How can I resolve contradictory results in HI_1594 functional studies?

    Contradictions in research findings are common when studying uncharacterized proteins . A systematic approach to resolving such contradictions includes:

    a) Systematic context analysis organized in a comparative framework:

    Context FactorStudy AStudy BPotential Impact on Results
    Internal factorsStrain variation, growth phaseDifferent strain, different phaseMay affect protein expression levels
    Experimental conditionsTemperature, media compositionDifferent conditionsMay activate different regulatory pathways
    MethodologyTechnique A with parameters XTechnique B with parameters YDifferent sensitivity or specificity
    Data analysisStatistical method 1Statistical method 2Different significance thresholds

    b) Design reconciliation experiments that:

    • Directly test hypotheses about the source of contradictions

    • Use multiple methodologies in parallel

    • Control for all variables systematically

    • Involve collaboration between groups reporting contradictory results

    c) Consider biological complexity:

    • HI_1594 might have multiple functions depending on context

    • Post-translational modifications might alter function

    • Protein moonlighting (multiple unrelated functions) is common in bacteria

  • What bioinformatic approaches can predict the structure and function of HI_1594?

    A comprehensive bioinformatic workflow for HI_1594 functional prediction should integrate multiple approaches :

    a) Sequence-based analysis:

    • BLAST searches against characterized proteins

    • Multiple sequence alignment to identify conserved residues

    • Profile-based searches (PSI-BLAST, HMMer)

    • Motif and domain identification (Pfam, PROSITE, InterPro)

    b) Structure prediction and analysis:

    • Ab initio structure prediction (AlphaFold, RoseTTAFold)

    • Structure-based function prediction (enzyme active site prediction)

    • Ligand binding site prediction

    • Structure comparison with characterized proteins

    c) Genomic context analysis:

    • Gene neighborhood analysis in H. influenzae and related species

    • Gene fusion detection

    • Phylogenetic profiling

    • Co-expression analysis with known virulence factors

    d) Integration of predictions using ensemble approaches that combine multiple lines of evidence for increased confidence in functional assignment .

  • How can I design a comprehensive high-throughput screening assay for HI_1594 functional studies?

    Developing a high-throughput screening (HTS) assay for an uncharacterized protein like HI_1594 requires a systematic approach:

    a) Identify potential functions based on bioinformatic predictions:

    • Enzymatic activity (hydrolase, transferase, etc.)

    • Binding to specific ligands or macromolecules

    • Role in particular cellular processes

    b) Assay development process:

    StageActivitiesQuality Metrics
    Initial assay designSelect assay format (fluorescence, luminescence, etc.)Scientific rationale
    OptimizationDetermine protein concentration, buffer, reagentsSignal-to-background ratio
    ValidationTest with control compounds or conditionsZ'-factor (>0.5 for robust assay)
    Pilot screeningSmall-scale test with representative libraryHit rate, confirmation rate
    Full-scale screeningComplete library screeningStatistical significance of hits
    Hit confirmationDose-response, orthogonal assaysEC50/IC50 values, specificity

    c) Assay formats suitable for HTS:

    • Fluorescence-based assays (FRET, polarization)

    • Enzyme-coupled assays for ATP/NAD(P)H detection

    • Thermal shift assays for ligand binding

    • Bioluminescence resonance energy transfer (BRET)

    d) Data analysis and interpretation:

    • Statistical methods for hit identification

    • Structure-activity relationship studies

    • Pathway and network analysis of hits

  • What are the appropriate controls for HI_1594 knockout studies in H. influenzae?

    Rigorous controls for HI_1594 knockout experiments should include:

    Control TypePurposeImplementation
    Genetic controlsValidate specificity of knockoutWild-type strain, complemented knockout strain, knockout of unrelated gene
    Expression validationConfirm absence of targetRT-PCR or RNA-seq for transcript, Western blot for protein
    Phenotypic controlsAccount for secondary effectsGrowth curves, stress response assays, multiple phenotypic assays
    Experimental controlsAccount for variabilityMultiple independent knockout clones, varied growth conditions
    Genomic controlsConfirm mutation and rule out othersWhole genome sequencing, PCR verification

    The complemented strain (knockout with plasmid-expressed HI_1594) is particularly critical as it demonstrates that observed phenotypes are specifically due to the absence of HI_1594 rather than polar effects or secondary mutations .

  • How can mass spectrometry be used to characterize potential post-translational modifications in HI_1594?

    Although bacteria like H. influenzae have fewer post-translational modifications (PTMs) than eukaryotes, they still exhibit important modifications that can affect protein function. A comprehensive mass spectrometry approach includes:

    a) Sample preparation strategies:

    • Enrichment of modified peptides (phosphopeptides, glycopeptides)

    • Multiple proteases for increased sequence coverage

    • Careful preservation of labile modifications

    b) MS analysis approaches:

    • Bottom-up proteomics: Analysis of enzymatically digested peptides

    • Top-down proteomics: Analysis of intact protein

    • Targeted approaches for predicted modifications

    c) Data analysis pipeline:

    Analysis StepTools/ApproachesConsiderations for HI_1594
    Database searchOpen and closed searchesInclude predicted modifications based on bacterial PTMs
    PTM localizationSite-determining algorithmsScore modification site confidence
    QuantificationLabel-free or labeling approachesCompare modification levels under different conditions
    ValidationSynthetic peptides, mutation studiesConfirm biological relevance of identified PTMs

    d) Common bacterial PTMs to investigate:

    • Phosphorylation (Ser, Thr, Tyr, His, Asp)

    • Acetylation (Lys, N-terminal)

    • Methylation

    • Bacterial glycosylations

  • What challenges might arise in crystallizing HI_1594 and how can they be overcome?

    Protein crystallization is often challenging, and for an uncharacterized protein like HI_1594, several specific hurdles might arise:

    a) Expression and purification challenges:

    • Low expression yield: Optimize codon usage, try different vectors

    • Insolubility: Use solubility enhancement tags, optimize buffer conditions

    • Heterogeneity: Improve purification protocols, use size exclusion chromatography

    b) Crystallization challenges and solutions:

    ChallengeSolution ApproachesScientific Rationale
    Finding initial conditionsSparse matrix screens (500+ conditions)Cast wide net for crystallization conditions
    Poor crystal qualityFine screening, additives, seedingOptimize crystal packing and growth
    No crystals formingSurface entropy reduction mutationsReduce flexible surface residues hindering crystal contacts
    Difficult phase determinationSelenomethionine labeling, heavy atom soakingProvide anomalous scatterers for experimental phasing
    Flexible regionsConstruct design with truncationsRemove disordered regions that hinder crystallization

    c) Alternative approaches if crystallization fails:

    • NMR spectroscopy for smaller proteins

    • Cryo-EM for larger assemblies

    • SAXS for low-resolution envelope information

    • Integrative structural biology combining multiple techniques

  • How can I analyze HI_1594 protein-protein interactions in the context of H. influenzae pathogenicity?

    Understanding protein-protein interactions (PPIs) is crucial for elucidating HI_1594's function in pathogenicity. A comprehensive approach includes:

    a) In silico methods:

    • Computational prediction of interaction partners

    • Docking simulations with potential partners

    • Network analysis of predicted functional associations

    b) In vitro methods:

    • Pull-down assays using tagged recombinant HI_1594

    • Surface plasmon resonance for quantitative binding analysis

    • Isothermal titration calorimetry for thermodynamic parameters

    c) In vivo methods:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation from H. influenzae lysates

    • Crosslinking mass spectrometry to capture transient interactions

    d) Validation and functional analysis:

    Validation ApproachInformation GainedApplication to Pathogenicity
    Mutational analysisIdentify key residues for interactionTarget for inhibitor design
    Competition assaysSpecificity of interactionsPotential for therapeutic intervention
    In vivo modelsBiological relevance of interactionRole in virulence mechanism
    Structural studiesMolecular basis of interactionStructure-based drug design

    e) Context-specific considerations:

    • Test interactions under conditions mimicking host environment

    • Examine interactions with host proteins (human respiratory epithelial proteins)

    • Study interaction dynamics during infection process

  • What methodologies can determine if HI_1594 is involved in H. influenzae antibiotic resistance?

    With increasing reports of multi-drug resistant H. influenzae , investigating HI_1594's potential role in resistance requires a multi-faceted approach:

    a) Comparative genomic analysis:

    • Compare HI_1594 sequence/expression between resistant and susceptible strains

    • Identify potential correlations with known resistance determinants

    • Analyze HI_1594 genomic context for proximity to resistance genes

    b) Genetic manipulation studies:

    • Generate HI_1594 knockout and determine minimum inhibitory concentrations (MICs)

    • Create HI_1594 overexpression strains and assess antibiotic susceptibility

    • Complement knockout with wild-type and mutant versions to identify critical domains

    c) Mechanistic investigations:

    Potential Resistance MechanismExperimental ApproachExpected Outcome if Involved
    Efflux pump activityEfflux inhibitor assays, accumulation studiesAltered drug accumulation in knockout
    β-lactamase activityNitrocefin hydrolysis assayChanged β-lactam hydrolysis rate
    Cell envelope modificationMembrane permeability assaysAltered membrane characteristics
    Target protectionTarget binding studiesChanged target-antibiotic interaction

    d) Transcriptomic/proteomic analysis:

    • RNA-seq comparing wild-type and HI_1594 mutants under antibiotic stress

    • Proteome analysis to identify downstream effects on resistance determinants

  • How can contradictory data in HI_1594 research literature be systematically analyzed and resolved?

    Based on research on contradictions in biomedical literature , a systematic approach includes:

    a) Contradiction mapping:

    • Extract predication instances from literature

    • Identify potentially contradictory claims

    • Classify contradictions by type and context

    b) Context analysis framework:

    Context CategoryExamplesAnalysis Approach
    Internal to the experimentSpecies differences, strain variationsCompare experimental subjects
    External to the experimentLab conditions, reagent sourcesExamine methodology details
    Endogenous/exogenous factorsNatural variation vs. introduced perturbationsSeparate inherent from experimental variables
    Known controversyEstablished disagreements in the fieldIdentify underlying theoretical differences
    Literature-based contradictionsDifferent interpretations of similar dataCompare analytical approaches

    c) Resolution strategies:

    • Design experiments specifically addressing contradictions

    • Meta-analysis of available data

    • Collaborative studies between groups with contradictory findings

    • Standardization of experimental protocols

  • What experimental design best tests if HI_1594 contributes to H. influenzae virulence in animal models?

    Testing HI_1594's role in virulence requires careful experimental design :

    a) Animal model selection:

    • Mouse models for bacteremia or pneumonia

    • Chinchilla model for otitis media

    • Rat model for meningitis

    b) Experimental design considerations:

    Design ElementImplementationRationale
    Strain preparationWild-type, HI_1594 knockout, complemented strainEnsure phenotype is specifically due to HI_1594
    Control groupsAge/weight-matched animals, sham infectionAccount for host variation and procedure effects
    RandomizationRandom assignment to experimental groupsMinimize selection bias
    BlindingBlinded assessment of outcomesPrevent observer bias
    Sample sizePower analysis-based determinationEnsure statistical significance

    c) Outcome measures:

    • Bacterial load in relevant tissues

    • Survival analysis

    • Histopathological assessment

    • Immune response parameters

    • Competitive index in mixed infections

    d) Advanced approaches:

    • In vivo imaging of infection progression

    • Single-cell analysis of host-pathogen interactions

    • Transcriptomics of host and pathogen during infection

    • Site-directed mutagenesis to identify key functional domains

    This comprehensive approach provides robust evidence for HI_1594's potential role in virulence, which could inform future therapeutic strategies against H. influenzae infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.