Recombinant Haemophilus influenzae Uncharacterized protein HI_1595 (HI_1595)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order remarks. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
HI_1595; Uncharacterized protein HI_1595
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1595
Target Protein Sequence
MIKQITERFTPRQYLAEFLLGLTALFGLYLIVAWSSYTPLDNSWATVSAYGNTINKVGSF GAWIIDLFFVFLGYVAHIIPFTAFLVPIYLLKTKAVKQLSCTRIILR
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae uncharacterized protein HI_1595?

HI_1595 is an uncharacterized protein encoded in the Haemophilus influenzae genome. As H. influenzae was the first free-living organism to have its entire genome sequenced, many proteins like HI_1595 were identified through genomic analysis but remain functionally uncharacterized . The protein is likely named according to the standard H. influenzae genome annotation convention, where HI refers to Haemophilus influenzae and the numerical identifier (1595) corresponds to its position in the annotated genome sequence. Like many uncharacterized bacterial proteins, its biological role, structure, and importance in pathogenesis remain subjects of active investigation.

How can researchers predict the potential function of HI_1595?

Functional prediction for uncharacterized proteins like HI_1595 typically begins with bioinformatic approaches including sequence homology analysis, domain prediction, and structural modeling. Researchers should employ multiple sequence alignment tools such as BLAST to identify homologous proteins in other organisms. Protein domain prediction tools including InterPro, Pfam, and SMART can identify conserved domains that might suggest function. For H. influenzae proteins specifically, comparative genomics with other Pasteurellaceae family members can provide additional context . Gene neighborhood analysis is particularly valuable, as genes with related functions often cluster together in bacterial genomes. Combining these approaches provides initial hypotheses about HI_1595's function that can then be tested experimentally.

Is HI_1595 likely to be conserved across different H. influenzae strains?

Conservation analysis of HI_1595 across H. influenzae strains would follow methodologies similar to those used in phylogenetic studies of other H. influenzae proteins. Based on studies of other H. influenzae proteins, conservation patterns tend to correlate with functional importance. Core genome proteins essential for bacterial survival typically show high conservation, while accessory genome proteins often display greater variation . To assess conservation, researchers should extract and align the HI_1595 sequences from multiple H. influenzae isolates representing different serotypes (a through f) and non-typeable strains. Phylogenetic analysis using tools like RAxML could then be employed to construct evolutionary relationships among these sequences, similar to approaches used for other H. influenzae virulence factors .

What expression systems are optimal for recombinant HI_1595 production?

Selection of an appropriate expression system for recombinant HI_1595 should consider several factors including protein solubility, yield, and downstream applications. Based on established protocols for H. influenzae proteins, E. coli-based expression systems (particularly BL21(DE3) or its derivatives) often serve as the first choice due to their rapid growth and high protein yields . For expression, the gene encoding HI_1595 should be codon-optimized for E. coli and cloned into vectors containing appropriate fusion tags (such as His6, GST, or MBP) to facilitate purification and potentially enhance solubility. If initial E. coli expression attempts yield insoluble protein, alternative expression hosts such as yeast (Pichia pastoris) or baculovirus-insect cell systems may prove more successful for obtaining soluble, properly folded HI_1595 .

What purification strategy would yield the highest purity of recombinant HI_1595?

A multi-step purification approach typically yields the highest purity for recombinant bacterial proteins like HI_1595. For His-tagged HI_1595, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins serves as an effective initial capture step. This should be followed by intermediate purification via ion exchange chromatography (selecting cation or anion exchange based on the protein's theoretical isoelectric point). Final polishing can be achieved through size exclusion chromatography (SEC), which separates the protein based on molecular size and provides information about the oligomeric state. For enhanced purity assessment, analytical techniques such as SDS-PAGE, Western blotting, and mass spectrometry should be employed to confirm the identity and purity of the recombinant HI_1595 . Throughout purification, buffer conditions should be optimized to maintain protein stability and solubility.

How can researchers validate the proper folding of recombinant HI_1595?

Proper protein folding is critical for functional studies of uncharacterized proteins like HI_1595. Multiple complementary techniques should be employed to assess protein folding. Circular dichroism (CD) spectroscopy can provide information about secondary structure content (α-helices, β-sheets). Thermal shift assays (differential scanning fluorimetry) can evaluate protein stability and the effects of different buffer conditions. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) offers insights into the oligomeric state and conformational homogeneity. For more detailed structural analysis, limited proteolysis followed by mass spectrometry can identify flexible and compact regions of the protein. Together, these approaches provide a comprehensive assessment of whether recombinant HI_1595 has attained its native fold prior to downstream functional or structural studies .

What gene knockout strategies would be most effective for studying HI_1595 function?

For genetic manipulation of HI_1595 in H. influenzae, several methodologies can be employed based on established protocols for this organism. Homologous recombination using suicide vectors carrying antibiotic resistance markers (typically kanamycin or tetracycline) flanked by sequences homologous to regions surrounding the HI_1595 gene represents the traditional approach. For precise gene editing without antibiotic markers, CRISPR-Cas9 systems adapted for H. influenzae would be advantageous, though may require optimization. Following knockout generation, comprehensive phenotypic characterization should include growth curve analysis under various conditions, morphological examination, biofilm formation assays, antibiotic susceptibility testing, and virulence assessment using infection models . Complementation studies, where the wild-type HI_1595 gene is reintroduced, are essential to confirm that observed phenotypes result specifically from HI_1595 deletion rather than polar effects or secondary mutations.

How can interactome studies help determine the function of HI_1595?

Protein interaction studies provide valuable insights into the functional networks involving uncharacterized proteins like HI_1595. Co-immunoprecipitation (Co-IP) using antibodies against tagged HI_1595 followed by mass spectrometry analysis represents a primary approach for identifying interaction partners. For more comprehensive interactome mapping, bacterial two-hybrid or proximity-dependent biotin identification (BioID) methods can be employed. Pull-down assays using purified recombinant HI_1595 as bait against H. influenzae cell lysates can validate direct interactions. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provide quantitative binding parameters for confirmed interactions. Network analysis of identified protein partners can then place HI_1595 within known biological pathways, providing functional context. Particular attention should be given to interactions with known virulence factors or immune evasion proteins, such as the complement regulator-binding protein H described in H. influenzae .

What transcriptomic approaches would reveal conditions affecting HI_1595 expression?

RNA-Seq analysis under various growth conditions can provide valuable insights into the regulation and potential function of HI_1595. Experimental conditions should include different growth phases, nutrient limitations, oxidative stress, iron restriction, exposure to host factors (serum, antimicrobial peptides), biofilm versus planktonic growth, and infection-relevant conditions such as low pH or reduced oxygen tension. Differential expression analysis comparing these conditions can identify stimuli that specifically upregulate or downregulate HI_1595. Co-expression network analysis might reveal genes with similar expression patterns, suggesting functional relationships. For validation, quantitative real-time PCR (qRT-PCR) should be performed on selected conditions showing significant HI_1595 expression changes. Promoter analysis using reporter constructs can further characterize transcriptional regulation mechanisms. This approach has successfully identified condition-specific expression patterns for various H. influenzae genes, including those involved in virulence and adaptation .

What crystallization strategies would be most effective for HI_1595?

Determining the crystal structure of HI_1595 would provide significant insights into its function. The crystallization strategy should begin with producing highly pure (>95%), monodisperse protein samples in a stable buffer identified through thermal shift assays. Initial crystallization screening should employ commercial sparse matrix screens at multiple protein concentrations (typically 5-20 mg/mL) and temperatures (4°C and 20°C). Both vapor diffusion (hanging and sitting drop) and microbatch methods should be tested. For proteins that resist crystallization, surface entropy reduction (SER) mutagenesis—replacing surface clusters of high-entropy residues (Lys, Glu) with alanines—can promote crystal formation. Additionally, screening crystallization with various ligands or binding partners identified from interactome studies may stabilize HI_1595 and facilitate crystallization. Once initial crystals are obtained, optimization of precipitation conditions, including fine adjustment of pH, precipitant concentration, and additives, would be performed to improve crystal quality for X-ray diffraction data collection .

How can integrative structural biology approaches enhance understanding of HI_1595?

A comprehensive structural characterization of HI_1595 would benefit from combining multiple complementary techniques. While X-ray crystallography provides high-resolution static structures, nuclear magnetic resonance (NMR) spectroscopy offers information about protein dynamics and can identify flexible regions. Small-angle X-ray scattering (SAXS) provides low-resolution structural information in solution and can be particularly valuable if crystallization proves challenging. Cryo-electron microscopy (cryo-EM) is increasingly useful for medium to large proteins or complexes. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of structural flexibility and ligand-binding sites. Computational approaches including molecular dynamics simulations can provide insights into protein motion and conformational changes relevant to function. The integration of these methods creates a more complete structural understanding of HI_1595 than any single technique alone, potentially revealing features critical for function that might be missed by a singular approach .

How might HI_1595 contribute to H. influenzae pathogenesis?

Investigating the potential role of HI_1595 in pathogenesis requires a multi-faceted approach combining in vitro and in vivo methodologies. Initial screens should assess whether HI_1595 deletion affects key virulence phenotypes including adherence to respiratory epithelial cells, resistance to serum killing, biofilm formation, and intracellular survival. Cell culture infection models using human respiratory epithelial cells can evaluate the impact of HI_1595 on host cell responses, including cytokine production and inflammatory pathway activation. For in vivo relevance, comparing wild-type and ΔHI_1595 strains in established mouse models of H. influenzae infection would assess colonization efficiency and disease progression. If HI_1595 shows structural similarity to known complement evasion proteins like the factor H-binding protein H (PH), specific assays for complement resistance should be performed . Transcriptomic or proteomic profiling of host cells exposed to wild-type versus ΔHI_1595 mutants could reveal affected host defense pathways, providing further mechanistic insights.

What is the relevance of HI_1595 for vaccine development or therapeutic targeting?

Evaluating HI_1595 as a potential vaccine candidate or therapeutic target would begin with immunogenicity and conservation analysis. For vaccine potential, key determinants include surface exposure (assessed by flow cytometry with anti-HI_1595 antibodies), sequence conservation across clinical isolates, immunogenicity, and protective efficacy. Recombinant HI_1595 could be tested in animal immunization studies to evaluate antibody responses and protective immunity against H. influenzae challenge. The protein's conservation across the six serotypes (a-f) should be thoroughly analyzed to determine if it could provide cross-protection beyond specific serotypes . If HI_1595 proves essential for bacterial viability or virulence, high-throughput screening approaches could identify small molecule inhibitors that might serve as leads for therapeutic development. Any identified compounds would require validation through binding assays, activity testing, and preliminary pharmacokinetic and toxicity studies.

How does HI_1595 compare to analogous proteins in other bacterial pathogens?

Comparative analysis of HI_1595 with homologous proteins in other bacterial species provides evolutionary and functional context. Researchers should perform comprehensive bioinformatic analyses including BLAST searches against multiple bacterial genomes, with particular focus on other respiratory pathogens and members of the Pasteurellaceae family. Multiple sequence alignment and phylogenetic tree construction can reveal evolutionary relationships and conserved functional motifs. Structural comparisons with solved homologous proteins can highlight conserved folds that suggest function. If HI_1595 belongs to a protein family with characterized members in other species, these insights can guide functional hypotheses and experimental design. Synteny analysis—examining the genomic context of HI_1595 homologs across species—may reveal conserved operon structures suggesting functional relationships. This comparative approach has proven valuable for understanding the evolution of virulence factors across bacterial pathogens and can provide insights even when direct functional data is limited .

What are the optimal conditions for expressing soluble recombinant HI_1595?

The expression of soluble recombinant H. influenzae proteins can be challenging due to potential toxicity or improper folding in heterologous systems. Based on experiences with other H. influenzae proteins, several approaches can be employed to optimize soluble expression of HI_1595:

Expression ParameterOptimization StrategyRationale
Expression temperatureLower to 16-25°CReduces protein synthesis rate, allowing proper folding
Induction conditionsLower IPTG (0.1-0.5 mM)Prevents overwhelming cellular machinery
Expression hostBL21(DE3) derivatives with additional chaperonesEnhances proper folding
Fusion tagsMBP, SUMO, or TRXIncreases solubility more effectively than His-tag alone
Media compositionAuto-induction mediaGradual protein expression without manual induction
Growth phaseInduce at higher OD600 (0.8-1.0)Cells better equipped to handle protein production

After optimization, solubility assessment should include both SDS-PAGE analysis of soluble versus insoluble fractions and functional assays to confirm that the soluble protein retains native properties .

How can researchers detect potential post-translational modifications in HI_1595?

Post-translational modifications (PTMs) can significantly influence protein function and should be thoroughly investigated for uncharacterized proteins like HI_1595. Mass spectrometry (MS) approaches represent the primary methodology for comprehensive PTM detection. High-resolution liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis of purified native HI_1595 (rather than recombinant protein, which may lack host-specific modifications) can identify PTMs through mass shifts corresponding to specific modifications. Common bacterial PTMs to investigate include phosphorylation, acetylation, methylation, and glycosylation. Enrichment strategies may be necessary for low-abundance modifications—phosphopeptide enrichment using titanium dioxide (TiO2) or immunoprecipitation with anti-phospho antibodies can increase detection sensitivity for phosphorylation sites. Site-directed mutagenesis of identified modified residues followed by functional assays can then determine the biological significance of these modifications in HI_1595 function .

What are the challenges in developing specific antibodies against HI_1595?

Development of specific antibodies against HI_1595 is crucial for many experimental applications but presents several challenges that must be addressed methodologically. Immunization strategies should include both the full-length recombinant protein and synthetic peptides corresponding to predicted antigenic epitopes (typically 15-20 amino acids from hydrophilic, surface-exposed regions). For polyclonal antibodies, rabbits or guinea pigs typically provide good responses to bacterial antigens. For monoclonal antibody development, screening should rigorously assess specificity through Western blotting against both recombinant HI_1595 and H. influenzae lysates. Cross-reactivity testing against related Haemophilus species and other respiratory pathogens is essential to ensure specificity. Epitope mapping using peptide arrays or hydrogen-deuterium exchange mass spectrometry (HDX-MS) can precisely identify the binding regions of generated antibodies. If cross-reactivity remains problematic, affinity purification against immobilized HI_1595 followed by negative selection against cross-reactive antigens can improve specificity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.