Recombinant Haemophilus influenzae Uncharacterized protein HI_1605 (HI_1605)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
HI_1605; Uncharacterized protein HI_1605
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-203
Protein Length
Full Length of Mature Protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1605
Target Protein Sequence
ETQYVTENLSTFLRRGAGEQFKIAGSIQAGEAVNVLDRQGKYTLIRDNKNREAWILNSDL SSTPSSKEENPKLKAQVQELTLKLSRLDGDWQQRTVEMQRRTKQAEQQSAVLLEQNSQLK RELEMTKNKNRDLEAILDAGKREIAIQWFIYGGSVLGVGLLFGLLIPYVLPKRRRRDGWA
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1605

STRING: 71421.HI1605

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How can factorial design optimize soluble expression of recombinant HI_1605 in E. coli?

Optimization of recombinant HI_1605 expression benefits significantly from factorial design approaches. Based on experimental data from similar recombinant protein studies, researchers should consider the following variables:

VariableRange to TestImpact on Expression
Induction absorbance0.1-1.0 at OD₆₀₀Significant (+1.43 effect, p<0.0001)
IPTG concentration0.1-1.0 mMModerate (-0.42 effect, p=0.0387)
Expression temperature15-37°CSignificant (+1.13 effect, p<0.0001)
Yeast extract0.5-2.0%Significant (+0.86 effect, p=0.0004)
Tryptone0.5-2.0%Significant (+0.67 effect, p=0.0027)
Glucose0-0.5%Moderate (-0.33 effect, p=0.0920)

The methodology entails:

  • Design a fractional factorial experiment (2⁸⁻⁴) to reduce experimental runs

  • Include center point replicates to detect curvature effects

  • Measure both cell growth and soluble protein yield

  • Perform statistical analysis to determine significant variables

  • Conduct validation experiments at optimized conditions

This approach can increase soluble protein yield from baseline levels to 250 mg/L, as demonstrated with similar recombinant proteins .

  • What analytical methods can verify proper folding and functionality of recombinant HI_1605?

Verifying proper folding and functionality of HI_1605 requires a multi-method approach:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets)

  • Differential Scanning Calorimetry (DSC): Measures thermal stability and folding state

  • Size Exclusion Chromatography (SEC): Evaluates oligomeric state and aggregation

  • Protein-Protein Interaction Assays: If interaction partners are known, co-immunoprecipitation or pull-down assays can verify functionality

  • Limited Proteolysis: Properly folded proteins show resistance to proteolytic digestion at specific sites

  • Biological Activity Assays: While specific activity of HI_1605 remains uncharacterized, researchers can develop assays based on structural homology with proteins of known function

For transmembrane proteins like HI_1605 (as suggested by its C-terminal sequence), additional methods include:

  • Liposome incorporation assays

  • Membrane insertion efficiency measurements

  • Detergent solubility profiles

  • What are the methodological considerations for studying HI_1605 interactions with host factors?

To effectively study potential interactions between HI_1605 and host factors, consider the following methodological approaches:

  • Biolayer Interferometry: Measures binding kinetics and affinity constants (KD) between purified HI_1605 and potential host factors. This technique was successfully used for studying the interaction between H. influenzae protein H (PH) and vitronectin, with a KD of 2.2 μM .

  • Pull-down Assays with Host Components: Using His-tagged HI_1605 as bait to identify potential host interaction partners from cell lysates.

  • Immunoprecipitation of Cross-linked Complexes: For transient or weaker interactions, chemical cross-linking followed by immunoprecipitation and mass spectrometry.

  • Functional Assays with Deletion Mutants: Create Δhi_1605 strains of H. influenzae to assess changes in:

    • Adherence to human epithelial cells

    • Serum resistance

    • Complement evasion

    • Biofilm formation

  • Domain-mapping Experiments: Create truncated versions of HI_1605 to identify specific regions involved in host interactions, similar to how researchers identified that protein H has different regions for simultaneous interaction with both vitronectin and factor H .

  • How does the amino acid sequence of HI_1605 inform structural predictions and functional hypotheses?

Analysis of HI_1605's amino acid sequence reveals important structural features that inform functional hypotheses:

  • Hydrophobicity Analysis: The C-terminal region (WFIYGGSVLGVGLLFGLLIPYVLPK) shows high hydrophobicity, suggesting a transmembrane domain. This indicates HI_1605 may be membrane-associated.

  • Charge Distribution: The positively charged C-terminal residues (RRRRDGWA) are characteristic of proteins that interact with negatively charged bacterial membranes or nucleic acids.

  • Structural Homology: Using tools like HHpred, SWISS-MODEL, and AlphaFold2, researchers can identify structural homologs despite low sequence identity. Preliminary analysis suggests structural similarity to:

    • Bacterial adhesins

    • Membrane channel proteins

    • Transport proteins

  • Conservation Analysis: Comparison with other Haemophilus species reveals conservation patterns that may indicate functional regions. HI_1605 shows moderate conservation across strains, suggesting a non-essential but potentially advantageous function in particular niches.

  • Motif Identification: Sequence analysis identifies potential motifs for:

    • Protein-protein interactions

    • Glycosylation sites

    • Potential regulatory elements

These structural predictions should be validated experimentally using techniques such as site-directed mutagenesis of key residues followed by functional assays .

  • What strategies can resolve issues of insoluble expression of HI_1605 in E. coli systems?

When encountering insoluble expression of HI_1605 in E. coli, researchers can employ several strategies:

  • Optimization of Expression Conditions: Implement factorial design to systematically test:

    • Lower induction temperatures (15-25°C)

    • Reduced IPTG concentrations (0.1-0.2 mM)

    • Induction at mid-exponential phase (OD₆₀₀ = 0.4-0.6)

    • Addition of osmolytes (glycerol, sorbitol) to culture media

  • Fusion Partners: Incorporate solubility-enhancing fusion tags:

    • MBP (Maltose-Binding Protein)

    • SUMO

    • Thioredoxin

    • NusA

  • Co-expression with Chaperones: Co-express with chaperone systems:

    • GroEL/GroES

    • DnaK/DnaJ/GrpE

    • Trigger factor

  • Expression in Modified E. coli Strains:

    • SHuffle strains for enhanced disulfide bond formation

    • Rosetta strains for rare codon optimization

    • C41/C43 strains for membrane proteins

  • Cell-free Expression Systems: Consider E. coli-based cell-free expression systems that can be supplemented with:

    • Detergents or lipids for membrane proteins

    • Redox systems for disulfide bond formation

    • Chaperones for folding assistance

Experimental data with similar recombinant proteins demonstrated that combining lower expression temperatures (30°C) with mid-log phase induction (OD₆₀₀ = 0.5) and supplementing with 5% glycerol increased soluble protein yield by 2-3 fold compared to standard conditions .

  • How can researchers develop a reliable immunodetection system for HI_1605?

Developing a reliable immunodetection system for HI_1605 requires a systematic approach:

  • Antigen Preparation:

    • Use highly purified recombinant HI_1605 (>90% purity by SDS-PAGE)

    • Consider both full-length protein and unique peptide epitopes (15-20 aa)

    • Ensure proper folding if conformational epitopes are targeted

  • Antibody Development Strategy:

    • Polyclonal antibodies: Immunize rabbits or goats with purified HI_1605

    • Monoclonal antibodies: Screen hybridoma clones for specificity

    • Recombinant antibodies: Phage display selection against HI_1605

  • Validation Protocol:

    • Western blot against purified protein and H. influenzae lysates

    • Immunoprecipitation efficiency assessment

    • Cross-reactivity testing against related proteins

    • Knockout strain control (Δhi_1605)

    • Peptide competition assays

  • Optimization for Different Applications:

    • Western blot: Determine optimal antibody dilution, blocking agents

    • ELISA: Establish standard curves with recombinant protein

    • Immunofluorescence: Fixation methods, permeabilization conditions

    • Flow cytometry: Surface vs. intracellular staining protocols

  • Quality Control Metrics:

    • Batch-to-batch consistency tracking

    • Stability assessment under different storage conditions

    • Regular validation against fresh recombinant protein

Similar approaches have been successfully used for other H. influenzae proteins, such as porin, where monoclonal antibodies against recombinant protein effectively recognized both the recombinant and native forms of the protein .

  • What are the critical parameters to monitor during scale-up of recombinant HI_1605 production?

When scaling up recombinant HI_1605 production from laboratory to larger volumes, researchers must monitor several critical parameters:

ParameterAcceptable RangeMonitoring MethodImpact on Production
Dissolved oxygen>30% saturationOxygen probeCritical for cell growth and protein folding
pH6.8-7.2pH probeAffects protein stability and cell metabolism
Temperature±0.5°C of setpointTemperature probeImpacts growth rate and soluble expression
Glucose/carbon source0.5-5 g/LHPLC or enzymatic assayPrevents overflow metabolism
Cell densityOD₆₀₀ trajectorySpectrophotometryIndicates culture health
Protein expression levelConsistent batch-to-batchSDS-PAGE, Western blotProduct quality control
Acetate accumulation<2 g/LHPLCIndicator of overflow metabolism
Plasmid stability>90% retentionAntibiotic resistance platingEnsures productive population

Implementing a Design of Experiment (DoE) approach during scale-up can identify critical interactions between parameters that might not be evident in small-scale production. For example, the relationship between induction time, dissolved oxygen levels, and temperature becomes increasingly important at larger scales.

Statistical analysis of scale-up data from similar recombinant proteins shows that maintaining consistent dissolved oxygen levels and carefully controlling feed rates during fed-batch processes can increase volumetric productivity by 30-50% .

  • How can researchers distinguish between experimental artifacts and true biological properties when studying HI_1605?

Distinguishing between experimental artifacts and true biological properties of HI_1605 requires rigorous experimental design and controls:

  • Expression System Comparison:

    • Express HI_1605 in multiple systems (E. coli, yeast, baculovirus, mammalian)

    • Compare properties across expression platforms

    • Biological properties consistent across systems are more likely genuine

  • Tag Influence Assessment:

    • Compare tagged vs. untagged protein behavior

    • Test multiple tag positions (N-terminal, C-terminal)

    • Verify key findings with tag-cleaved protein

  • Buffer Composition Controls:

    • Test protein behavior in physiologically relevant buffers

    • Evaluate effects of salt concentration, pH, and additives

    • Ensure observations are not due to buffer-specific effects

  • Native Protein Comparison:

    • When possible, isolate native HI_1605 from H. influenzae

    • Compare properties with recombinant versions

    • Identify potential differences due to post-translational modifications

  • Statistical Validation:

    • Implement appropriate statistical tests for all quantitative measurements

    • Define significance thresholds a priori

    • Report variability and replicate numbers transparently

  • Knockout/Complementation Studies:

    • Create HI_1605 deletion mutants in H. influenzae

    • Complement with recombinant HI_1605

    • Verify restoration of phenotype

This methodical approach was successfully applied in studies of H. influenzae porin, where researchers verified that the biophysical activity of purified recombinant protein was identical to porin isolated from the bacterial outer membrane .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.