Recombinant Haemophilus influenzae Uncharacterized protein HI_1620 (HI_1620)

What is Haemophilus influenzae Uncharacterized protein HI_1620?

Haemophilus influenzae Uncharacterized protein HI_1620 (UniProt ID: P44273) is a protein consisting of 167 amino acids found in the Gram-negative human pathogen Haemophilus influenzae, which primarily resides in the upper respiratory tract . The protein can be recombinantly expressed with an N-terminal His tag in E. coli systems . The full amino acid sequence is:

MKIHHLFQPHFRLIYLFIWGLIISGLSDLTWLIPLNVLAVSLFFISLQFSQKSFLPYLKRWFALVIFIVLMWATLSWKIGENGIELNFQGIELAEKLSLRTHLLLISLWLFLWNINDAVLVPSHWQIAFARKINSTFCADRTLHCTAWRIASKNGYCHARSWISSSA

Analysis of this sequence reveals multiple hydrophobic regions, suggesting potential membrane association. Its specific function remains uncharacterized, though it may be related to pathogenesis given that H. influenzae employs various strategies to circumvent host immune responses, including evasion of the complement system .

How is Recombinant HI_1620 protein typically produced?

Recombinant production of HI_1620 typically involves expression in E. coli expression systems following these general steps:

• The full-length gene encoding HI_1620 (amino acids 1-167) is cloned into an expression vector with an N-terminal His-tag .

• The construct is transformed into E. coli and expressed under optimized conditions.

• The protein is purified, likely using affinity chromatography exploiting the His-tag.

• The final purified protein is typically provided as a lyophilized powder .

For reconstitution and storage, the following protocol is recommended:

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis .

What structural characteristics does HI_1620 exhibit?

Based on available information, HI_1620 has several notable structural characteristics:

• It is a relatively small protein of 167 amino acids with an estimated molecular weight of approximately 18-20 kDa (excluding the His-tag) .

• Sequence analysis reveals regions with high hydrophobicity, particularly segments with leucine, isoleucine, phenylalanine, and valine residues, suggesting potential membrane-spanning domains or association with membrane structures .

• The amino acid sequence contains multiple potential alpha-helical regions, which is consistent with transmembrane proteins.

• When recombinantly expressed, it can be fused with an N-terminal His-tag while maintaining stability and integrity, suggesting the N-terminus is accessible and not critical for protein folding .

A predicted structural topology might include:

• N-terminal region (likely cytoplasmic based on recombinant expression success)

• Potential transmembrane segments

• Intervening loop regions

• C-terminal domain

Without experimental structural data from X-ray crystallography, NMR, or cryo-EM, the precise three-dimensional structure remains speculative.

What is currently known about the function of HI_1620?

The specific biological function of HI_1620 remains largely uncharacterized, as indicated by its designation as an "uncharacterized protein" . Based on the context of H. influenzae biology, several hypotheses about its function can be considered:

• Given that H. influenzae is a respiratory pathogen that employs various strategies to evade host immune responses , HI_1620 might play a role in pathogenesis or immune evasion.

• Its predicted membrane association suggests possible functions in:

  • Membrane integrity or transport

  • Cell envelope biogenesis

  • Sensing environmental signals

  • Interaction with host cells or extracellular components

• As H. influenzae expresses proteins that interact with host complement regulators (such as the identified protein H that binds factor H) , HI_1620 could potentially have similar immune evasion functions.

• Comparative genomic studies in other bacteria suggest uncharacterized proteins often serve roles in stress responses, adaptation to specific niches, or specialized metabolic functions.

Despite these possibilities, definitive functional characterization requires experimental evidence through approaches such as gene knockout studies, protein interaction analyses, and phenotypic characterization.

How can I design experiments to characterize the function of HI_1620?

Designing experiments to characterize the function of an uncharacterized protein like HI_1620 requires a multi-faceted approach:

• Computational Analysis and Prediction:

  • Perform sequence alignment with characterized proteins

  • Identify conserved domains and motifs

  • Predict secondary structure and membrane topology

  • Analyze genomic context and gene neighborhood

• Expression and Regulation Studies:

  • Determine expression profiles under different conditions (pH, temperature, nutrient availability)

  • Analyze expression during infection models or exposure to host factors

  • Identify regulatory elements controlling HI_1620 expression

• Genetic Manipulation Approaches:

  • Generate HI_1620 knockout or knockdown strains

  • Create complementation constructs

  • Develop inducible or repressible expression systems

  • Apply site-directed mutagenesis to modify specific residues

• Phenotypic Characterization:

  • Compare growth characteristics of wild-type and mutant strains

  • Evaluate resistance to various stressors

  • Assess virulence properties similar to studies with protein H

  • Examine biofilm formation, adhesion, and invasion capabilities

• Protein Interaction Studies:

  • Identify binding partners through pull-down assays

  • Screen for interactions with host factors

  • Investigate potential oligomerization

  • Map interaction domains

• Structural Biology Approaches:

  • Determine 3D structure through X-ray crystallography, NMR, or cryo-EM

  • Analyze structure-function relationships

  • Identify potential active sites or binding pockets

The ChIP-exo approaches used for uncharacterized transcription factors in E. coli could be adapted if DNA-binding activity is suspected.

What are the optimal conditions for expressing and purifying HI_1620?

Based on available information and general principles for recombinant membrane-associated proteins, the following optimization strategy is recommended:

Expression Optimization Table:

Purification Strategy:

• Cell Lysis:

  • Buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Include protease inhibitors

  • For membrane-associated proteins, add appropriate detergents (start with 1% Triton X-100)

• Affinity Purification:

  • Ni-NTA affinity chromatography

  • Washing with increasing imidazole concentrations (10-40 mM)

  • Elution with 250-500 mM imidazole

• Buffer Exchange and Storage:

  • Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successful

  • Concentrate to desired concentration (0.1-1.0 mg/mL)

  • Add glycerol (5-50%) for cryoprotection

• Quality Control:

  • SDS-PAGE analysis (target >90% purity)

  • Consider Western blot confirmation

  • Assess proper folding by circular dichroism if possible

The specific optimization will depend on the intended application and downstream experimental requirements.

How can I assess the potential role of HI_1620 in pathogenesis?

To assess the potential role of HI_1620 in H. influenzae pathogenesis, a systematic approach combining genetic, biochemical, and infection models is required:

• Genetic Approaches:

  • Generate HI_1620 knockout strains similar to the approach used for protein H (PH) in H. influenzae

  • Create complemented strains to confirm phenotype specificity

  • Develop conditional expression systems to control HI_1620 levels

• In Vitro Virulence Assays:

  Assay	Methodology	Expected Outcome if Involved in Pathogenesis
  Serum resistance	Expose bacteria to human serum and measure survival	Reduced survival in Δhi_1620 strain (similar to ΔlpH strains)
  Complement activation	Measure C3b deposition by flow cytometry	Increased C3b deposition on Δhi_1620 strain
  Adhesion assays	Quantify bacterial attachment to respiratory epithelial cells	Altered adherence in Δhi_1620 strain
  Biofilm formation	Crystal violet staining of in vitro biofilms	Defective biofilm formation in Δhi_1620 strain
  Antimicrobial peptide resistance	Survival in presence of defensins or cathelicidins	Increased sensitivity in Δhi_1620 strain

• Host Factor Interaction Studies:

  • Investigate if HI_1620 binds host factors (complement components, extracellular matrix proteins)

  • Use pull-down assays, surface plasmon resonance, or ELISA techniques

  • Compare binding capacity with known virulence factors like protein H

• Cellular Response Assays:

  • Measure inflammatory cytokine production by host cells

  • Assess NF-κB activation or inflammasome responses

  • Quantify phagocytosis rates by neutrophils and macrophages

• Animal Models:

  • Compare colonization and disease progression between wild-type and Δhi_1620 strains

  • Measure bacterial load, inflammation, and host survival

  • Consider tissue-specific effects in respiratory infection models

• Clinical Correlation:

  • Examine hi_1620 sequences across clinical isolates

  • Correlate expression levels with disease severity

  • Investigate presence in invasive versus non-invasive strains

Similar to the study of protein H, which demonstrated reduced FH binding and decreased serum resistance in knockout strains , these approaches should reveal if HI_1620 contributes to H. influenzae pathogenesis.

What techniques can be used to study protein-protein interactions involving HI_1620?

Several complementary techniques can be employed to identify and characterize protein-protein interactions involving HI_1620:

• Affinity-Based Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant HI_1620 to pull down interaction partners

  • Pull-down assays: Immobilize purified HI_1620 and expose to bacterial or host cell lysates

  • Protein microarrays: Screen HI_1620 against arrays of potential interaction partners

• Genetic-Based Methods:

  • Bacterial two-hybrid systems: Particularly useful for prokaryotic protein interactions

  • Yeast two-hybrid (Y2H): Can be used with careful controls for membrane proteins

  • Protein-fragment complementation assays: Split reporter proteins that activate upon HI_1620 interaction with partners

• Biophysical Methods:

  • Surface plasmon resonance (SPR): Measures real-time binding kinetics and affinity constants

  • Isothermal titration calorimetry (ITC): Determines thermodynamic parameters of binding

  • Microscale thermophoresis (MST): Detects interactions based on thermophoretic mobility changes

• Structural Methods:

  • X-ray crystallography of protein complexes: Provides atomic-level details of interaction interfaces

  • Cryo-electron microscopy: Visualizes larger protein complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps binding interfaces

• Cross-linking Methods:

  • Chemical cross-linking coupled with mass spectrometry: Identifies proximal protein regions

  • Photo-reactive amino acid incorporation: Allows site-specific cross-linking

  • In vivo cross-linking: Captures physiologically relevant interactions

• Proximity-Based Methods:

  • Förster resonance energy transfer (FRET): Detects closely interacting proteins

  • Bioluminescence resonance energy transfer (BRET): Alternative to FRET with lower background

  • Proximity ligation assay (PLA): Visualizes protein interactions in situ

• Label-Free Methods:

  • Native mass spectrometry: Preserves non-covalent interactions

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determines complex stoichiometry

When designing these studies, consider the approaches used to characterize the interaction between protein H (PH) and factor H , adapting methods to investigate whether HI_1620 might similarly interact with host factors.

How might HI_1620 relate to known virulence factors in H. influenzae?

Understanding how HI_1620 relates to established virulence factors in H. influenzae requires a comparative analytical approach:

• Genomic Context Analysis:

  • Examine if HI_1620 is located within or near known pathogenicity islands

  • Identify if it's co-transcribed with characterized virulence genes

  • Assess conservation across virulent versus less pathogenic H. influenzae strains

  • Compare with the distribution pattern of protein H, which is found in invasive Hib and Hif isolates

• Transcriptional Regulation Patterns:

  • Determine if HI_1620 shares regulatory mechanisms with established virulence factors

  • Analyze if it responds to the same environmental cues that trigger virulence gene expression

  • Identify common transcription factors that might control both HI_1620 and virulence genes

• Functional Categorization:

  • Based on preliminary characterization, place HI_1620 within functional categories of virulence:

  Virulence Category	Established Factors	Potential HI_1620 Connection
  Immune evasion	Protein H (factor H binding) , IgA protease	May interact with complement regulators
  Adhesion	Pili, adhesins, HMW proteins	Membrane location suggests possible adhesion role
  Invasion	Opacity proteins	Could facilitate penetration of epithelial barriers
  Nutrient acquisition	Transferrin binding proteins	Might participate in micronutrient uptake
  Biofilm formation	Phosphorylcholine, LOS	Could contribute to community structure

• Protein Interaction Network:

  • Map direct protein-protein interactions between HI_1620 and known virulence factors

  • Identify if HI_1620 is part of virulence-associated protein complexes

  • Determine if it shares interaction partners with established virulence proteins

• Comparative Phenotypic Analysis:

  • Assess if HI_1620 mutations produce phenotypes similar to mutations in known virulence genes

  • Compare effects on serum resistance, similar to protein H deletion studies

  • Evaluate impact on colonization, persistence, and invasive potential

• Structural and Evolutionary Relationships:

  • Analyze if HI_1620 shares structural motifs with characterized virulence factors

  • Determine if it evolved through similar evolutionary pressures as virulence factors

  • Assess if horizontal gene transfer events might have introduced HI_1620

This systematic comparison would help position HI_1620 within the broader virulence network of H. influenzae and guide further functional characterization.

What are the challenges in studying uncharacterized proteins like HI_1620?

Studying uncharacterized proteins like HI_1620 presents several significant challenges that researchers must address through careful experimental design:

• Lack of Functional Context:

  • No established assays to measure activity

  • Unknown binding partners or substrates

  • Uncertain biological pathways involved

  • Difficult to design positive controls

• Technical Challenges in Protein Expression and Purification:

  • Potential membrane association of HI_1620 complicates expression

  • Optimal detergents for solubilization must be determined empirically

  • Maintaining native conformation during purification

  • Ensuring proper folding in recombinant systems

• Experimental Design Complexities:

  • Determining appropriate experimental conditions

  • Designing relevant functional assays without knowing function

  • Establishing suitable controls for unbiased analysis

  • Need for double-blind study designs to prevent confirmation bias

• Genetic Manipulation Considerations:

  • Potential essential nature making knockout generation difficult

  • Possible functional redundancy masking phenotypes

  • Unknown regulation affecting complementation experiments

  • Polar effects on adjacent genes

• Interpretative Challenges:

  • Distinguishing direct from indirect effects

  • Separating physiological from artifactual interactions

  • Correlating in vitro observations with in vivo relevance

  • Avoiding overinterpretation of preliminary results

• Comparative Analysis Limitations:

  • Few characterized homologs for functional inference

  • Limited structural data for modeling

  • Uncertain evolutionary relationships

  • Species-specific functions without clear parallels

• Validation Hurdles:

  • Multiple complementary approaches needed for confidence

  • Higher burden of proof for novel function claims

  • Reproducibility across different experimental systems

  • Need for extensive controls and replicates

These challenges necessitate a systematic, multi-pronged approach similar to that employed for uncharacterized transcription factors in E. coli , combining computational prediction, experimental validation, and rigorous controls.

What are the best approaches for structural analysis of HI_1620?

Structural analysis of HI_1620 requires a strategic combination of complementary techniques to overcome challenges associated with uncharacterized membrane-associated proteins:

The recombinant HI_1620 protein available with His-tag purification provides a good starting point for these structural studies, though optimization of conditions will be necessary for membrane protein analysis.

How can I design knockout studies to investigate HI_1620 function?

Designing effective knockout studies to investigate HI_1620 function requires careful planning and appropriate controls:

• Knockout Strategy Selection:

  Method	Advantages	Considerations for HI_1620
  Homologous recombination	Precise, complete deletion	Standard in H. influenzae, similar to approach used for protein H
  CRISPR-Cas9	Rapid, versatile	May require optimization for H. influenzae
  Transposon mutagenesis	High-throughput	Less precise, may have polar effects
  Antisense RNA	Tunable knockdown	Incomplete silencing

• Construct Design Considerations:

  • Include 500-1000 bp homology arms flanking HI_1620

  • Select appropriate antibiotic resistance marker

  • Consider marker removal systems (FLP/FRT or Cre/loxP)

  • Design to minimize polar effects on adjacent genes

  • Include unique restriction sites for verification

• Verification of Knockout:

  • PCR screening with primers outside the homology region

  • Sequencing across the deletion junction

  • RT-PCR to confirm absence of transcript

  • Western blot if antibodies are available

  • Whole genome sequencing to confirm single integration

• Complementation System Design:

  • Reintroduce HI_1620 under native promoter

  • Use site-specific integration or stable plasmid

  • Include epitope tag for detection if needed

  • Create point mutants for structure-function analysis

  • Employ inducible promoters for controlled expression

• Phenotypic Analysis Framework:

  Phenotype Category	Assays	Controls
  Growth characteristics	Growth curves in different media	Wild-type, complemented strain
  Stress response	Survival under oxidative, osmotic, pH stress	Multiple stressors to determine specificity
  Host interaction	Adhesion, invasion, serum resistance	Compare with known virulence factor mutants
  Transcriptome	RNA-seq of knockout vs. wild-type	Multiple biological replicates
  Proteome	Comparative proteomics	Include technical and biological replicates

• Experimental Design Best Practices:

  • Use multiple independently derived knockout clones

  • Implement double-blind experimental protocols

  • Include full set of controls in every experiment

  • Perform statistical power analysis to determine sample size

  • Document all growth conditions and experimental parameters

• Advanced Approaches:

  • Create conditional knockouts for essential genes

  • Generate domain-specific deletions

  • Construct double mutants to identify redundant functions

  • Develop reporter fusions to monitor expression

Following the example in search result , where researchers deleted the gene encoding protein H (PH) and observed reduced factor H binding and serum resistance, similar functional assays could be applied to HI_1620 knockout strains.

What are the recommended protocols for handling and storing recombinant HI_1620?

Proper handling and storage of recombinant HI_1620 is crucial for maintaining protein integrity and experimental reproducibility. Based on the information provided , the following comprehensive protocol is recommended:

Handling Protocol:

• Initial Reception:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Document lot number and date received

• Preparation for Reconstitution:

  • Equilibrate vial to room temperature in a desiccator

  • Briefly centrifuge vial before opening to collect contents at the bottom

  • Work in a clean environment to avoid contamination

• Reconstitution Procedure:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Gently rotate or invert to dissolve; avoid vigorous vortexing

  • Allow complete dissolution (5-15 minutes)

  • Filter through 0.22 μm filter if needed for downstream applications

Storage Recommendations:

Aliquoting Best Practices:

• Prepare small, single-use aliquots

• Use screw-cap microcentrifuge tubes

• Label with protein name, concentration, date, and initials

• Record freeze-thaw cycles for each aliquot

Stability Considerations:

• Avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for maximum one week

• Include protease inhibitors if degradation is observed

• Consider flash-freezing aliquots in liquid nitrogen

Quality Control Measures:

• Periodically verify protein integrity by SDS-PAGE

• Document physical appearance before and after storage

• Maintain a sample usage log with experimental outcomes

• Run functional assays (once established) to confirm activity

Buffer Considerations:

• The protein has been stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

• Maintain this buffer composition when possible

• If buffer exchange is necessary, perform gradually and monitor protein stability

Following these guidelines will help ensure consistent experimental results when working with recombinant HI_1620 protein.

How can I validate antibodies against HI_1620 for immunoassays?

Validating antibodies against HI_1620 for immunoassays requires a systematic approach to ensure specificity, sensitivity, and reproducibility. The following comprehensive validation strategy is recommended:

• Initial Validation with Recombinant Protein:

  Test	Procedure	Acceptance Criteria
  Western Blot	Serial dilutions of recombinant HI_1620	Single band at expected MW, linear dose response
  ELISA	Titration curve with recombinant protein	Specific binding with saturation, low background
  Dot Blot	Direct application of denatured and native protein	Signal with both conformations or specific to one

• Specificity Controls:

  • Test against recombinant HI_1620 with tag removed

  • Screen against lysates from HI_1620 knockout strains

  • Examine cross-reactivity with closely related proteins

  • Include non-specific IgG controls at same concentration

  • Pre-absorb antibody with recombinant protein to confirm specificity

• Application-Specific Validation:

  Application	Validation Approach	Controls
  Immunoprecipitation	Pull-down of endogenous or tagged HI_1620	IgG control, knockout lysate
  Immunofluorescence	Staining of wild-type vs. knockout	Secondary antibody only, peptide competition
  ChIP/ChIP-exo	Similar to approach in reference	Input DNA, non-specific IgG
  Flow cytometry	Surface staining if HI_1620 is external	Isotype control, blocking validation

• Validation in Native Context:

  • Test in H. influenzae lysates (wild-type)

  • Compare with knockout or knockdown samples

  • Verify signal in fractionated samples (membrane vs. cytosolic)

  • Examine signal under conditions where HI_1620 expression changes

• Double-Blind Testing:

  • Prepare coded samples containing various amounts of HI_1620

  • Have a different researcher perform the immunoassay

  • Analyze results without knowledge of sample identity

  • Compare decoded results with expected values

• Quantitative Assessment:

  • Determine detection limit

  • Establish linear range of detection

  • Calculate signal-to-noise ratio

  • Assess inter- and intra-assay variability

• Documentation Requirements:

  • Antibody source, catalog number, lot number

  • Complete experimental conditions

  • Images of full blots/gels with molecular weight markers

  • All controls run in parallel

  • Detailed protocols enabling reproduction

• Advanced Characterization:

  • Epitope mapping to determine binding region

  • Affinity measurement (SPR, BLI)

  • Cross-species reactivity assessment

  • Effects of post-translational modifications on recognition

This rigorous validation approach ensures that antibodies used in HI_1620 research will generate reliable, reproducible, and interpretable results across different experimental applications.

What are the appropriate controls for experiments involving HI_1620?

Designing appropriate controls is crucial for generating reliable and interpretable results in experiments involving HI_1620. The following comprehensive control strategy should be implemented:

• Genetic Manipulation Controls:

  Experiment Type	Essential Controls	Purpose
  Gene knockout	Wild-type strain, complemented strain	Verify phenotype is due to HI_1620 absence
  Overexpression	Empty vector control, inactive mutant	Distinguish specific from non-specific effects
  Reporter fusion	Promoterless construct, constitutive control	Normalize expression data
  Complementation	Vector-only, point mutants	Confirm functional rescue

• Protein Interaction Controls:

  • Non-binding protein with same tag as HI_1620

  • Beads-only or matrix-only controls

  • Competition with excess unlabeled protein

  • Irrelevant protein of similar size/structure

  • Structurally altered HI_1620 (denatured or mutated)

• Biochemical Assay Controls:

  • Buffer-only baseline

  • Heat-inactivated HI_1620

  • Concentration gradients to establish dose-response

  • Positive control (known protein with similar function)

  • Time-course controls

• Immunological Method Controls:

  • Pre-immune serum or isotype control

  • Secondary antibody only

  • Blocking peptide competition

  • Knockout/knockdown sample verification

  • Cross-reactivity assessment

• Microscopy Controls:

  • Unstained samples for autofluorescence

  • Single-color controls for spectral overlap

  • Fixed cells without primary antibody

  • Known subcellular markers for co-localization studies

• Expression Analysis Controls:

  • No template controls for PCR

  • Multiple reference genes for normalization

  • Standard curves for absolute quantification

  • Biological and technical replicates

  • Positive and negative regulators

• Experimental Design Controls:

  • Double-blind experimental setup

  • Randomization of sample processing

  • Multiple biological replicates

  • Independent experimental repetitions

  • Inclusion of established positive controls

• Data Analysis Controls:

  • Appropriate statistical tests

  • Multiple comparison corrections

  • Effect size calculations

  • Power analysis to determine sample size

  • Alternative analytical methods to confirm findings

When studying potential roles in pathogenesis, controls similar to those used in the protein H study should be implemented, including comparison of wild-type and mutant strains in serum resistance assays, with appropriate positive and negative controls.