Recombinant Haemophilus influenzae Uncharacterized protein HI_1622 (HI_1622)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_1622; Uncharacterized protein HI_1622
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-161
Protein Length
Full Length of Mature Protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1622
Target Protein Sequence
LYVFAQYDGQTLSGKSYYSDMTPAAETYLEVFRSGVSDPVLTGKTDRQGVFKLSIADVPH TTLKVVVEGDEGHRASVVAAHTSAENQSGADLMLLREDIAHLKDKIYLHDILGGIGYIVG IAGLIALRNARKIKQGRI
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1622

STRING: 71421.HI1622

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the structure and function of HI_1622 in Haemophilus influenzae?

HI_1622 is currently classified as an uncharacterized protein in Haemophilus influenzae, similar to many proteins categorized as Domains of Unknown Function (DUFs). While its precise biological role remains to be determined, preliminary sequence analysis suggests it may belong to a conserved bacterial protein family. Like many DUFs, HI_1622 likely performs a non-essential function, as systematic knockout screens in related bacteria have shown that only approximately 4% of essential genes have unknown functions .

The methodological approach to characterize HI_1622 should begin with computational analysis including sequence homology searches, structural prediction, and identification of conserved domains. This should be followed by experimental characterization including expression profiling, localization studies, and interaction partner identification through techniques such as co-immunoprecipitation or bacterial two-hybrid systems.

How can I express and purify recombinant HI_1622 for structural and functional studies?

Recombinant expression of HI_1622 can be achieved using established protocols for H. influenzae proteins. A recommended approach involves:

  • Gene cloning into an expression vector with an inducible promoter (such as T7)

  • Replacement of any N-terminal lipid modification signal sequence with a protein secretion signal if membrane association is suspected

  • Expression in an appropriate E. coli strain under optimized conditions

For purification, a strategy similar to that used for other H. influenzae proteins can be employed, typically involving:

  • Cell lysis under native conditions

  • Initial capture using affinity chromatography (if tagged)

  • Secondary purification via ion exchange or gel filtration chromatography

This approach has successfully yielded high-purity recombinant H. influenzae proteins in previous studies, such as the bacterial lipoprotein e (P4) . Specifically, high levels of recombinant protein can be achieved after IPTG induction, with subsequent purification to apparent homogeneity after two chromatography steps .

What is the prevalence and conservation of HI_1622 across different H. influenzae strains?

While specific data on HI_1622 conservation is not directly provided in the search results, comparative genomic approaches can be applied based on recent large-scale studies of H. influenzae populations. Recent whole-genome sequencing of over 4,000 isolates from northwestern Thailand, combined with nearly 6,000 published genomes, has revealed that H. influenzae has a highly admixed population structure with low core genome nucleotide diversity .

To determine HI_1622 conservation:

  • Conduct BLAST searches against the comprehensive H. influenzae genome database

  • Analyze sequence variation across clinical and laboratory isolates

  • Determine if HI_1622 belongs to the core or accessory genome

What are the optimal conditions for expressing soluble recombinant HI_1622 in E. coli?

Based on established protocols for H. influenzae proteins, the following expression conditions are recommended for HI_1622:

Expression system:

  • Vector: pET-based expression vector with T7 promoter

  • Host strain: BL21(DE3) or derivatives like Rosetta for rare codon optimization

  • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

Optimization parameters:

  • Temperature: 16-30°C (lower temperatures often increase solubility)

  • Induction time: 4-16 hours

  • Media composition: Standard LB or enriched media for higher yield

Solubility enhancement strategies:

  • Fusion tags: MBP, SUMO, or thioredoxin to enhance solubility

  • Co-expression with chaperones (GroEL/ES, DnaK/J)

  • Addition of 0.1-1% glucose to suppress basal expression

For membrane-associated proteins, strategies similar to those employed for H. influenzae lipoprotein e (P4) could be beneficial, including replacing the N-terminal lipid modification signal sequence with one for protein secretion without such modification .

How can I determine if HI_1622 belongs to a known protein domain family despite being uncharacterized?

Determining domain relationships for uncharacterized proteins like HI_1622 requires a multifaceted approach:

Computational methods:

  • PSI-BLAST searches against non-redundant protein databases

  • Hidden Markov Model (HMM) searches against domain databases (Pfam, SMART)

  • Structural prediction using tools like AlphaFold or I-TASSER

  • Analysis of conserved motifs and secondary structure elements

Experimental validation:

  • Solve the three-dimensional structure using X-ray crystallography or cryo-EM

  • Structure-based comparisons can reveal relationships not detectable through sequence analysis alone

This combined approach has successfully reclassified many DUFs. For example, DUF27 (PF01661) was shown to possess adenosine phosphate-ribose 1′-phosphate processing activity and was subsequently renamed as the MACRO domain .

Table 1: Key Resources for Domain Identification of Uncharacterized Proteins

ResourceApplicationURLCitations
PfamDomain classificationhttps://pfam.xfam.org/-
PROSITEMotif identificationhttps://prosite.expasy.org/-
CATHStructural classificationhttps://www.cathdb.info/-
DALIStructural comparisonhttp://ekhidna2.biocenter.helsinki.fi/dali/-
PROLINKSFunctional prediction-
AlphaFold DBStructure predictionhttps://alphafold.ebi.ac.uk/-

What are the recommended approaches for functional characterization of HI_1622?

A systematic approach to functional characterization of HI_1622 should include:

Genetic approaches:

  • Gene deletion/knockout studies to assess phenotypic changes

  • Complementation assays to confirm phenotypes

  • TREP (Transformed Recombinant Enrichment Profiling) to investigate the genetic basis of phenotypic variation

Biochemical approaches:

  • Activity assays based on predicted function classes (hydrolase, transferase, etc.)

  • Protein-protein interaction studies (pull-down, bacterial two-hybrid)

  • Ligand binding assays to identify potential substrates

Structural approaches:

  • X-ray crystallography or cryo-EM to determine 3D structure

  • Structural comparison with characterized proteins to infer function

Omics approaches:

  • Transcriptomics to identify co-regulated genes

  • Proteomics to identify interaction partners

  • Metabolomics to identify affected metabolic pathways in knockout strains

This multi-dimensional approach has successfully elucidated functions for many previously uncharacterized proteins and could be particularly effective for HI_1622.

How might HI_1622 contribute to H. influenzae pathogenesis and intracellular invasion?

While the specific role of HI_1622 in pathogenesis is currently unknown, we can consider potential contributions based on knowledge of H. influenzae virulence mechanisms:

Potential roles in pathogenesis:

  • Adhesion and invasion - If HI_1622 functions similarly to known adhesins like HMW1, it might contribute to attachment to host cells or intracellular invasion

  • Immune evasion - It could potentially interfere with host immune responses

  • Nutrient acquisition - It might play a role in acquiring essential nutrients in the host environment

  • Biofilm formation - It could contribute to bacterial aggregation and biofilm development

To investigate these possibilities, researchers should consider:

  • Comparing HI_1622 expression between invasive and non-invasive strains

  • Testing a HI_1622 knockout strain for altered invasion capabilities in airway epithelial cell models

  • Employing TREP methodology, which has successfully identified virulence factors like HMW1 adhesin that increased intracellular invasion ~1,000-fold when transferred to laboratory strains

What techniques can be used to study potential protein-protein interactions involving HI_1622?

Understanding protein-protein interactions is crucial for elucidating the function of uncharacterized proteins like HI_1622. Recommended techniques include:

In vitro approaches:

  • Pull-down assays using recombinant HI_1622 as bait

  • Surface Plasmon Resonance (SPR) to measure binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic binding parameters

In vivo approaches:

  • Bacterial two-hybrid system adapted for H. influenzae

  • Chemical cross-linking followed by mass spectrometry

  • Co-immunoprecipitation from H. influenzae lysates

Computational predictions:

  • Protein-protein interaction databases

  • Conserved gene neighborhood analysis

  • Co-expression network analysis

Table 2: Advantages and Limitations of Protein Interaction Techniques for Bacterial Proteins

TechniqueAdvantagesLimitationsRecommended Controls
Pull-downDirect physical interaction, identifies complexesHigh false positives, requires tagNon-specific binding resin, unrelated protein
Bacterial two-hybridIn vivo context, scalableMay miss transient interactionsEmpty vector, non-interacting protein pairs
Cross-linking MSCaptures weak/transient interactionsComplex data analysisNon-crosslinked samples, random protein
Co-IPNative conditions, captures complexesRequires specific antibodyPre-immune serum, unrelated antibody

How can structural genomics approaches aid in determining the function of HI_1622?

Structural genomics offers powerful approaches for uncharacterized proteins like HI_1622:

Key structural genomics strategies:

  • High-throughput structure determination

  • Structure-based function prediction

  • Identification of distant functional relationships based on structural similarity

Even when sequence similarities are not detectable, structural relationships can reveal functional connections. For example, DUF442 (PF04273) was shown to be a nonclassical phosphatase enzyme based on structural similarity to known enzymes, despite lacking sequence-level conservation .

For HI_1622, researchers should:

  • Determine the high-resolution structure using X-ray crystallography or cryo-EM

  • Use structure comparison tools like DALI to identify similar fold families

  • Look for conserved active site architectures

  • Employ computational docking to predict potential ligands or substrates

These approaches have revolutionized our understanding of DUFs, with structural genomics initiatives successfully annotating numerous previously uncharacterized protein families.

How should I interpret conflicting data regarding HI_1622 function across different H. influenzae strains?

When facing conflicting functional data for HI_1622 across different strains, consider:

Sources of variation:

  • Genetic background differences - H. influenzae has a highly admixed population structure

  • Allelic variation - Different variants may have different functions

  • Regulatory differences - Expression levels may vary across strains

  • Experimental conditions - Growth conditions may affect protein function

Resolution approaches:

  • Sequence the HI_1622 gene from each strain to identify polymorphisms

  • Perform complementation studies with different alleles

  • Analyze the regulatory context of HI_1622 in each strain

  • Standardize experimental conditions across studies

Remember that H. influenzae exhibits significant genomic diversity, with whole-genome sequencing of over 10,000 isolates revealing complex population structures . Functional variation of HI_1622 may reflect this diversity and potentially contribute to strain-specific phenotypes.

What statistical methods are most appropriate for analyzing HI_1622 expression data across different experimental conditions?

For robust analysis of HI_1622 expression data:

Recommended statistical approaches:

  • For qRT-PCR data:

    • Normalize to multiple reference genes using geometric mean

    • Use ΔΔCt method with efficiency correction

    • Apply ANOVA with post-hoc tests for multiple comparisons

  • For RNA-Seq data:

    • Normalize using DESeq2 or edgeR

    • Account for batch effects using ComBat or RUVSeq

    • Apply FDR correction for multiple testing

  • For proteomics data:

    • Use LFQ or TMT-based normalization

    • Apply ANOVA or linear mixed models

    • Account for technical variability with appropriate controls

Sample size considerations:

  • Minimum 3 biological replicates per condition

  • Power analysis to determine adequate sample size based on expected effect size

Table 3: Statistical Analysis Guidelines for Expression Data

Data TypeNormalization MethodStatistical TestMultiple Testing CorrectionSoftware Tools
qRT-PCRMultiple reference genesANOVA, t-testBonferroni, Tukey HSDqBase+, REST
RNA-SeqTMM, RLEDESeq2, edgeRBenjamini-Hochberg FDRR, Galaxy
ProteomicsLFQ, iBAQMSstats, LIMMAQ-value, FDRPerseus, R

What are common troubleshooting strategies for poor expression or insolubility of recombinant HI_1622?

When encountering expression or solubility issues with HI_1622:

Expression troubleshooting:

  • Verify plasmid sequence integrity

  • Optimize codon usage for E. coli

  • Test multiple E. coli strains (BL21, C41/C43, Arctic Express)

  • Vary induction parameters (IPTG concentration, temperature, time)

  • Test different media formulations

Solubility troubleshooting:

  • Reduce expression temperature (16-20°C)

  • Add solubility-enhancing additives (glycerol, arginine, sorbitol)

  • Try different detergents for membrane-associated proteins

  • Use fusion partners (MBP, SUMO, thioredoxin)

  • Consider cell-free expression systems

Purification optimization:

  • Screen multiple buffer conditions (pH, salt concentration)

  • Test different purification strategies (IMAC, ion exchange, SEC)

  • Include stabilizing ligands if known

For H. influenzae proteins specifically, researchers have successfully employed strategies like replacing N-terminal lipid modification signal sequences with secretion signals to improve solubility and purification .

How can I design effective knockout or knockdown experiments to study HI_1622 function in H. influenzae?

For genetic manipulation of HI_1622 in H. influenzae:

Gene knockout strategies:

  • Homologous recombination with antibiotic resistance cassette

  • Natural transformation-based approaches leveraging H. influenzae's natural competence

  • CRISPR-Cas9 system adapted for H. influenzae

Verification methods:

  • PCR confirmation of gene deletion

  • RT-PCR to confirm absence of transcript

  • Western blot to confirm absence of protein

  • Whole genome sequencing to exclude off-target effects

Experimental design considerations:

  • Include complementation controls to confirm phenotypes

  • Use multiple independent knockout clones

  • Consider conditional knockouts if essential

  • Account for potential polar effects on downstream genes

The natural competence of H. influenzae can be leveraged for genetic manipulation, as demonstrated in TREP studies where transformation was used to generate complex pools of recombinants followed by phenotypic selection .

How might high-throughput screening approaches be applied to determine HI_1622 function?

High-throughput screening offers powerful approaches to elucidate HI_1622 function:

Phenotypic screening:

  • Growth condition arrays (carbon sources, stress conditions)

  • Chemical genomics (compound libraries)

  • Transposon mutagenesis coupled with deep sequencing (Tn-Seq)

  • Synthetic genetic arrays to identify genetic interactions

Biochemical screening:

  • Substrate libraries for enzymatic activity

  • Ligand binding arrays

  • Protein interaction screens using phage display or Y2H

Data integration:

  • Combine multiple screening approaches

  • Integrate with bioinformatics predictions

  • Correlate with transcriptomics and proteomics data

Similar approaches have successfully identified functions for other DUFs. For example, DUF27 was found to possess adenosine phosphate-ribose 1′-phosphate processing activity through systematic screening, leading to its reclassification as the MACRO domain .

What potential role might HI_1622 play in antimicrobial resistance mechanisms in H. influenzae?

Given increasing multi-drug resistance (MDR) in H. influenzae globally , HI_1622's potential role in antimicrobial resistance merits investigation:

Potential mechanisms:

  • Direct involvement in drug efflux or modification

  • Role in biofilm formation facilitating antibiotic tolerance

  • Involvement in stress response pathways

  • Contribution to altered membrane permeability

Experimental approaches:

  • Compare HI_1622 expression between susceptible and resistant isolates

  • Test antibiotic susceptibility of HI_1622 knockout strains

  • Investigate structural similarity to known resistance factors

  • Examine co-expression with known resistance genes

Recent genomic studies have identified a large number of nearly pan-resistant H. influenzae lineages, and their establishment globally is an urgent concern . Understanding the contribution of uncharacterized proteins like HI_1622 to this resistance could provide valuable insights for developing countermeasures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.