Recombinant Haemophilus influenzae Uncharacterized protein HI_1701 (HI_1701)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its inclusion during development.
Synonyms
HI_1701; Uncharacterized protein HI_1701
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1701
Target Protein Sequence
MLELGKLLTALIAPPLNTFVLLIIAAIIYCVHFKKLAKFIAIISFTWLYIMSAPFTGLLL TNNDDSPALTLDEYKQAQAIVILGGGSYQTKELYAETASGAPQLERLRYAAFLQKETGLP ILTTGYSLIGISEGDLMAKELNQFFNVPTQWIENKARNTEENASFTKNILIKDHIQKIIL VTNQWHMKRAKYLFEKQGFDVLPAAAASYGSKGNLSAKSFIPDLGALNSNMVLLKEWIGY WKAHYVE
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1701

STRING: 71421.HI1701

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HI_1701 and why is it classified as an uncharacterized protein?

HI_1701 is a protein encoded by the Haemophilus influenzae genome that has not been experimentally characterized, and its functions cannot be definitively deduced from simple sequence comparisons alone . It belongs to a category of proteins often referred to as "hypothetical" or "conserved hypothetical" in genome annotations. These proteins comprise a significant fraction of bacterial genomes, including that of H. influenzae, and represent gaps in our understanding of bacterial proteomes . The classification as "uncharacterized" indicates that while the protein's existence is predicted based on genomic data, its biological function, cellular localization, interaction partners, and role in bacterial physiology remain undefined through direct experimental evidence.

What are the basic structural characteristics of recombinant HI_1701?

Recombinant HI_1701 from Haemophilus influenzae is a full-length protein comprising 247 amino acids (residues 1-247) . When produced as a recombinant protein, it is typically expressed with a histidine tag (His-tag) to facilitate purification. The protein is commonly expressed in Escherichia coli expression systems, which allow for efficient production of bacterial proteins . While detailed three-dimensional structural information is not available in the provided search results, standard recombinant protein techniques including affinity chromatography can be employed to purify the His-tagged HI_1701 for structural and functional studies.

How is the gene encoding HI_1701 identified in genomic studies?

The gene encoding HI_1701 was identified during genome sequencing and annotation of Haemophilus influenzae. The identification process typically involves computational prediction of open reading frames (ORFs) within the bacterial genome, followed by comparative genomic analyses to determine if similar sequences exist in other organisms . For hypothetical genes like HI_1701, initial classification often occurs through automated genome annotation pipelines that assign preliminary identifiers based on genomic location. Further analysis using tools like PSI-BLAST can reveal potential functional relationships, though in the case of truly uncharacterized proteins, these computational predictions require experimental validation . Genome-wide expression studies can confirm that the gene is transcribed and translated under specific conditions, providing evidence that it is a genuine protein-coding gene rather than a pseudogene.

What is known about the genomic context of HI_1701?

The genomic context of HI_1701 within the Haemophilus influenzae genome could provide valuable clues about its potential function, though specific details about its genomic neighborhood are not explicitly described in the search results. Analysis of genomic context is a standard approach used for hypothetical proteins, examining adjacent genes that may be functionally related, particularly if they appear to form an operon structure . Comparative genomic approaches examining gene neighborhoods across multiple bacterial species can further strengthen functional predictions. While the specific genomic context of HI_1701 is not detailed in the provided information, researchers studying this protein would typically analyze surrounding genes, their orientation, and potential co-regulation patterns to generate hypotheses about HI_1701's biological role.

What are the most effective expression systems for producing functional recombinant HI_1701?

  • Expression vector selection: While pGEM vectors are mentioned in relation to other recombinant constructs , specialized expression vectors with strong inducible promoters (T7, tac, or ara) may provide better yields for HI_1701.

  • Codon optimization: Since H. influenzae and E. coli have different codon usage patterns, codon optimization of the HI_1701 sequence for E. coli expression may improve yields.

  • Expression conditions: Optimization of induction parameters (temperature, inducer concentration, duration) is crucial for obtaining properly folded protein.

  • Solubility enhancement: For potentially insoluble proteins, fusion tags beyond the His-tag (such as MBP, GST, or SUMO) might improve solubility.

  • Native host expression: For functional studies, expression in Haemophilus species might preserve native folding and post-translational modifications, though yield would likely be lower.

The choice between these approaches should be guided by the intended downstream applications and the required protein quality.

What computational approaches are most effective for predicting the function of HI_1701?

Multiple computational approaches should be employed in combination to predict the function of uncharacterized proteins like HI_1701:

  • Sequence-based methods: Beyond basic BLAST searches, researchers should utilize position-specific iterated BLAST (PSI-BLAST) which can detect remote homology relationships that single-iteration BLAST might miss . This approach has successfully provided tentative characterizations for previously uncharacterized H. influenzae proteins.

  • Structural prediction: Tools such as AlphaFold2 and RoseTTAFold can predict protein structures with increasing accuracy, even in the absence of close homologs. Structural similarities to characterized proteins can suggest functional relationships not evident from sequence alone.

  • Domain and motif analysis: Scanning for conserved domains using CDD/COG databases and motif identification can identify functional regions .

  • Genomic context analysis: Examining gene neighborhood, conservation patterns across species, and potential operon structures can provide functional clues.

  • Protein-protein interaction predictions: Tools that predict physical interactions based on co-evolution patterns can suggest potential binding partners.

The integration of multiple predictive methods typically provides stronger functional hypotheses than any single approach.

How can researchers design experiments to determine the subcellular localization of HI_1701 in Haemophilus influenzae?

Determining the subcellular localization of HI_1701 requires a multi-faceted experimental approach:

  • Computational prediction: Begin with in silico prediction tools (SignalP, TMHMM, PSORTb) to generate initial hypotheses about localization (cytoplasmic, membrane-associated, periplasmic, or secreted).

  • Fluorescent protein fusions: Generate C- and N-terminal GFP (or similar fluorescent protein) fusions with HI_1701 and express them in H. influenzae to visualize localization via fluorescence microscopy.

  • Subcellular fractionation: Perform biochemical fractionation of H. influenzae cells to separate cytoplasmic, membrane, periplasmic, and extracellular fractions, followed by Western blot detection of native HI_1701 using specific antibodies.

  • Immunogold electron microscopy: Use antibodies against HI_1701 conjugated to gold particles to precisely localize the protein at ultrastructural resolution.

  • Protease accessibility assays: For potential membrane proteins, determine topology by assessing protease sensitivity of different protein regions in intact cells versus permeabilized cells.

These complementary approaches can provide robust evidence for the subcellular compartment where HI_1701 functions, which would offer significant clues about its biological role.

What strategies are most effective for identifying potential interaction partners of HI_1701?

To identify potential interaction partners of HI_1701, researchers should employ multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS): Express His-tagged HI_1701 in H. influenzae, perform crosslinking if necessary, purify the protein using affinity chromatography, and identify co-purifying proteins by mass spectrometry.

  • Bacterial two-hybrid (B2H) screening: Use B2H systems to screen for binary interactions between HI_1701 and a library of H. influenzae proteins.

  • Co-immunoprecipitation (Co-IP): Generate specific antibodies against HI_1701 to immunoprecipitate the native protein complex from H. influenzae lysates, followed by mass spectrometry identification of binding partners.

  • Proximity-based labeling: Express HI_1701 fused with enzymes like BioID or APEX2 that can biotinylate nearby proteins, allowing for the capture and identification of proteins in close proximity, even if interactions are transient.

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): Use these biophysical techniques to validate and characterize specific binding interactions identified by other methods.

Combining these approaches will provide a comprehensive interaction network that can substantially inform functional hypotheses for this uncharacterized protein.

How should researchers design knockout or knockdown experiments to study HI_1701 function?

Designing effective knockout or knockdown experiments for HI_1701 requires careful planning:

  • Complete gene deletion:

    • Design primers to amplify upstream and downstream regions of HI_1701

    • Clone these regions into a suicide vector flanking an antibiotic resistance marker

    • Transform H. influenzae and select for double crossover events

    • Confirm deletion by PCR and sequencing

  • Conditional knockdown approaches:

    • Implement a regulatable promoter system (such as tet-inducible) upstream of HI_1701

    • Design antisense RNA constructs targeting HI_1701 mRNA

    • Consider CRISPR interference (CRISPRi) to repress transcription without genome modification

  • Phenotypic evaluation:

    • Growth curve analysis under various conditions (different media, stress conditions)

    • Transcriptomic profiling to identify compensatory responses

    • Metabolomic analysis to detect metabolic pathway disruptions

    • Virulence assessment in appropriate infection models if H. influenzae pathogenesis is studied

  • Complementation controls:

    • Reintroduce wild-type HI_1701 at a neutral site in the genome

    • Use an inducible complementation system to ensure the observed phenotypes are specifically due to HI_1701 loss

This systematic approach will provide insights into whether HI_1701 is essential under certain conditions and what biological processes it might influence.

What expression analysis techniques are most appropriate for studying HI_1701 regulation?

To comprehensively analyze HI_1701 expression regulation, researchers should employ multiple techniques:

  • Quantitative RT-PCR (qRT-PCR):

    • Design primers specific to HI_1701 and reference genes

    • Monitor expression under different growth phases and environmental conditions

    • Use relative quantification to normalize expression levels

  • Transcriptional reporter fusions:

    • Clone the HI_1701 promoter region upstream of reporter genes (like lacZ or gfp)

    • Measure reporter activity under different conditions to identify regulatory cues

    • Create promoter truncations to map important regulatory elements

  • RNA-Seq analysis:

    • Perform whole-transcriptome sequencing under various conditions

    • Identify co-expressed genes that may share regulatory mechanisms with HI_1701

    • Map transcription start sites and potential non-coding RNA regulators

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors binding to the HI_1701 promoter region

    • Perform ChIP-seq to map genome-wide binding patterns of identified regulators

    • Validate interactions with electrophoretic mobility shift assays (EMSA)

  • Proteomics approaches:

    • Use mass spectrometry to quantify HI_1701 protein levels under different conditions

    • Compare transcript and protein levels to identify post-transcriptional regulation

These approaches will reveal when, where, and how HI_1701 is expressed in H. influenzae, providing crucial context for functional studies.

What recombinant protein purification strategies are most effective for HI_1701?

For optimal purification of recombinant HI_1701, the following strategy is recommended:

  • Initial affinity chromatography:

    • Express HI_1701 with a histidine tag as indicated in available resources

    • Use Ni-NTA or TALON resin for initial capture

    • Optimize imidazole concentration in wash buffers to minimize non-specific binding

    • Elute with imidazole gradient to obtain initial enrichment

  • Secondary purification:

    • Employ ion exchange chromatography based on the predicted isoelectric point of HI_1701

    • Consider size exclusion chromatography to separate monomeric protein from aggregates and remove remaining impurities

    • If necessary, use hydrophobic interaction chromatography as a complementary separation technique

  • Buffer optimization:

    • Screen different buffer compositions (pH, salt concentration, additives) to maximize stability

    • Consider the addition of glycerol or arginine to prevent aggregation

    • Test reducing agents if cysteine residues are present

  • Quality control:

    • Assess purity by SDS-PAGE and mass spectrometry

    • Verify protein folding by circular dichroism or intrinsic fluorescence

    • Evaluate monodispersity by dynamic light scattering

  • Scale-up considerations:

    • Implement automated chromatography systems for reproducible purification

    • Optimize conditions to maintain consistency between batches

This systematic approach should yield pure, homogeneous HI_1701 suitable for structural and functional studies.

How can researchers validate computational predictions about HI_1701 function experimentally?

Validating computational functional predictions for HI_1701 requires a systematic experimental approach:

  • Biochemical activity assays:

    • If sequence or structural analysis suggests enzymatic activity, design specific assays to test predicted catalytic functions

    • Test substrate specificity with a panel of potential substrates based on computational predictions

    • Perform enzyme kinetics studies to characterize activity parameters

  • Structural validation:

    • Determine the three-dimensional structure using X-ray crystallography or cryo-EM

    • Compare actual structure with computational predictions to validate folding patterns

    • Identify potential active sites or binding pockets

  • Mutational analysis:

    • Generate point mutations in predicted functional residues

    • Assess the impact on protein function, stability, and interaction capabilities

    • Create domain deletion constructs to evaluate the contribution of different protein regions

  • Phenotypic complementation:

    • If HI_1701 shares predicted functional similarity with characterized proteins in other organisms, test whether it can complement corresponding mutants

  • Heterologous expression studies:

    • Express HI_1701 in model systems where the predicted pathway is well characterized

    • Assess whether expression leads to expected phenotypic changes

This multifaceted approach provides robust validation of computational predictions and can distinguish between alternative functional hypotheses.

What statistical approaches are most appropriate for analyzing HI_1701 expression data across different experimental conditions?

For robust statistical analysis of HI_1701 expression data:

  • Exploratory data analysis:

    • Assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Create box plots and scatter plots to visualize data distribution

    • Check for outliers using methods such as Cook's distance

  • Differential expression analysis:

    • For comparing two conditions: t-test (parametric) or Mann-Whitney U test (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni) or Kruskal-Wallis with Dunn's test

    • Use false discovery rate (FDR) correction for multiple testing when analyzing HI_1701 among many genes

  • Time-course analysis:

    • Apply repeated measures ANOVA for parametric data

    • Consider mixed-effects models to account for both fixed and random effects

    • Use time-series analysis methods for extended temporal studies

  • Correlation analysis:

    • Pearson correlation for linear relationships between HI_1701 and other genes

    • Spearman rank correlation for non-linear monotonic relationships

    • Network-based approaches to position HI_1701 in co-expression networks

  • Sample size and power considerations:

    • Conduct power analysis to determine appropriate sample sizes

    • Implement biological replicates (n≥3) and technical replicates to ensure robustness

How should researchers design experiments to assess whether HI_1701 plays a role in Haemophilus influenzae pathogenesis?

To assess potential roles of HI_1701 in H. influenzae pathogenesis:

  • Infection model selection:

    • Choose appropriate models based on the type of infections caused by H. influenzae

    • Consider cell culture models (epithelial cells, macrophages) for initial screening

    • Evaluate animal models that recapitulate specific aspects of H. influenzae infection (respiratory infection, otitis media, meningitis)

  • Mutant construction and characterization:

    • Generate HI_1701 deletion mutants and complemented strains

    • Characterize growth in standard media to rule out general growth defects

    • Assess basic virulence properties (biofilm formation, adherence to host cells)

  • Virulence assessment:

    • Compare wild-type, mutant, and complemented strains in infection models

    • Measure bacterial burden, inflammatory responses, and host tissue damage

    • Evaluate survival and competitive index in mixed infections

  • Host response analysis:

    • Perform transcriptomics or proteomics on infected host cells/tissues

    • Compare immune responses between wild-type and mutant infections

    • Assess specific virulence mechanisms (serum resistance, immune evasion)

  • Strain variation studies:

    • Compare HI_1701 sequence and expression across clinical isolates

    • Correlate variations with virulence potential and clinical outcomes

    • Consider typeable vs. non-typeable H. influenzae differences

This experimental framework will provide comprehensive evidence regarding any role HI_1701 might play in the pathogenic potential of H. influenzae.

How does HI_1701 compare to similar uncharacterized proteins in other bacterial species?

A comprehensive comparative analysis of HI_1701 with similar proteins in other bacteria should include:

  • Sequence-based comparisons:

    • Perform detailed sequence alignments using sensitive tools like PSI-BLAST

    • Identify true orthologs versus paralogs using phylogenetic analysis

    • Calculate sequence conservation patterns to identify functionally important residues

  • Taxonomic distribution analysis:

    • Map the presence/absence of HI_1701 homologs across bacterial taxa

    • Determine if the protein is restricted to Haemophilus species or more broadly distributed

    • Correlate distribution patterns with bacterial lifestyle (pathogens vs. commensals)

  • Genomic context conservation:

    • Compare gene neighborhoods around HI_1701 orthologs

    • Identify synteny patterns that might suggest functional associations

    • Look for co-evolution with specific gene sets across species

  • Structural comparison:

    • Compare predicted or experimental structures of HI_1701 homologs

    • Identify conserved structural features that may indicate shared functions

    • Analyze conservation of potential binding sites or catalytic regions

  • Expression pattern comparison:

    • Compare available expression data for HI_1701 homologs under similar conditions

    • Identify shared regulatory patterns that might indicate conserved functions

This comparative approach can reveal evolutionary insights and functional clues that aren't apparent from studying HI_1701 in isolation.

What methodologies are most appropriate for studying post-translational modifications of HI_1701?

To characterize potential post-translational modifications (PTMs) of HI_1701:

  • Mass spectrometry-based approaches:

    • Perform bottom-up proteomics using various proteases to maximize sequence coverage

    • Apply top-down proteomics to analyze intact protein and preserve modification stoichiometry

    • Use enrichment strategies for specific PTMs (phosphopeptide enrichment, glycopeptide enrichment)

    • Employ electron transfer dissociation (ETD) or electron capture dissociation (ECD) for labile modification analysis

  • Site-directed mutagenesis:

    • Mutate predicted modification sites and assess impacts on function

    • Create phosphomimetic mutations (S/T to D/E) to simulate phosphorylation

    • Generate non-modifiable variants to study physiological relevance

  • Specific labeling techniques:

    • Use phospho-specific antibodies if commercial options exist or generate custom antibodies

    • Apply chemical labeling approaches (e.g., PhosTAG for phosphorylation)

    • Consider metabolic labeling techniques if performing pulse-chase experiments

  • Bioinformatic prediction:

    • Use specialized software to predict potential modification sites

    • Compare predictions across homologs to identify conserved modification motifs

    • Integrate with structural models to assess accessibility of predicted sites

  • Physiological relevance:

    • Identify potential modifying enzymes in H. influenzae

    • Study modifications under different growth conditions

    • Correlate modifications with protein activity or localization changes

This comprehensive approach will reveal whether HI_1701 undergoes post-translational regulation and how this impacts its function.

What experimental approaches can determine if HI_1701 is involved in essential cellular processes in Haemophilus influenzae?

To determine if HI_1701 is involved in essential processes:

  • Conditional expression systems:

    • Place HI_1701 under an inducible promoter in the native locus

    • Attempt deletion of the native gene in the presence of the inducible copy

    • Monitor growth upon depletion by removing the inducer

    • Quantify viability at different expression levels

  • Transposon mutagenesis approaches:

    • Perform saturating transposon mutagenesis and sequence insertion sites

    • Analyze insertion patterns to determine if HI_1701 tolerates disruption

    • Compare results across different growth conditions to identify conditional essentiality

  • CRISPR interference (CRISPRi):

    • Design guide RNAs targeting HI_1701

    • Use catalytically inactive Cas9 (dCas9) to repress transcription

    • Titrate repression levels and measure impacts on growth

    • Apply in different environmental conditions to assess context-dependent essentiality

  • Metabolic impact assessment:

    • Monitor key metabolites upon HI_1701 depletion using targeted metabolomics

    • Measure ATP levels, redox balance, and other core metabolic indicators

    • Identify specific metabolic pathways affected by HI_1701 depletion

  • Cellular morphology and division analysis:

    • Examine cell morphology, membrane integrity, and nucleoid organization

    • Track division rates and potential division defects

    • Use fluorescent D-amino acids to monitor peptidoglycan synthesis

These approaches will determine whether HI_1701 is essential for viability and identify the cellular processes it might regulate.

How can researchers determine the three-dimensional structure of HI_1701 and its implications for function?

For determining HI_1701's three-dimensional structure and functional implications:

  • X-ray crystallography approach:

    • Optimize purification to obtain highly pure, homogeneous protein

    • Perform crystallization screening using commercial kits and custom conditions

    • Optimize promising crystallization conditions for diffraction quality

    • Collect diffraction data and solve structure using molecular replacement or experimental phasing

    • Refine structure to generate high-quality atomic models

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable if HI_1701 forms larger complexes or is difficult to crystallize

    • Prepare samples on grids and vitrify for data collection

    • Process micrographs and perform particle picking

    • Generate 3D reconstructions and build atomic models

  • NMR spectroscopy:

    • Suitable if HI_1701 is small enough (<25-30 kDa)

    • Express isotopically labeled protein (13C, 15N)

    • Collect multidimensional NMR spectra for structural determination

    • Analyze protein dynamics in solution

  • Structure-function analysis:

    • Identify potential binding pockets or catalytic sites

    • Compare to structural homologs to generate functional hypotheses

    • Design mutations based on structural features

    • Perform molecular docking with potential ligands or substrates

  • Integrative approaches:

    • Combine multiple structural techniques (SAXS, HDX-MS, crosslinking-MS)

    • Use computational modeling to fill gaps in experimental data

    • Validate models with biochemical and functional assays

This structural characterization will provide critical insights into how HI_1701's three-dimensional organization relates to its biological function.

What are the most promising research directions for understanding HI_1701 function in the broader context of Haemophilus influenzae biology?

The most promising future research directions for HI_1701 include:

  • Systematic phenotypic screening:

    • Subject HI_1701 mutants to comprehensive phenotypic arrays

    • Test growth under hundreds of different conditions (nutrients, stressors, antibiotics)

    • Identify specific conditions where HI_1701 becomes important for survival or growth

  • Integration with systems biology:

    • Position HI_1701 within protein-protein interaction networks

    • Incorporate into metabolic models of H. influenzae

    • Analyze in context of transcriptional regulatory networks

    • Connect to host-pathogen interaction networks if relevant

  • Comparative biology approaches:

    • Extend analysis to HI_1701 homologs in other Haemophilus species and related bacteria

    • Determine if function is conserved or has diverged

    • Correlate functional changes with bacterial adaptation to different niches

  • Host-pathogen interaction studies:

    • Investigate HI_1701's potential role during infection processes

    • Study expression patterns during host colonization

    • Assess impact on interactions with host immune components

  • Technological advances application:

    • Apply emerging methods like proximity labeling to map protein neighborhoods

    • Use CRISPR-based approaches for precise genome manipulation

    • Implement single-cell techniques to study cell-to-cell variability in expression

These complementary approaches will position HI_1701 within the broader context of H. influenzae biology and potentially reveal unexpected functions of this uncharacterized protein.

What are the potential biotechnological applications of recombinant HI_1701 if its function is fully characterized?

If HI_1701's function is fully characterized, potential biotechnological applications might include:

  • Antimicrobial development:

    • If essential for H. influenzae viability, HI_1701 could be a target for novel antibiotics

    • Structure-based drug design could yield specific inhibitors

    • Target validation would require demonstration of essentiality in diverse clinical isolates

  • Vaccine development:

    • If surface-exposed or secreted, HI_1701 could serve as a vaccine antigen

    • Recombinant protein could be used for immunization studies

    • Conservation across strains would need to be assessed for broad coverage

  • Diagnostic applications:

    • Development of specific antibodies against HI_1701 for diagnostic tests

    • PCR-based detection of the encoding gene in clinical samples

    • Potential biomarker for specific H. influenzae infections

  • Protein engineering:

    • If HI_1701 possesses useful enzymatic activity, protein engineering could enhance its properties

    • Structure-guided design could improve stability, activity, or specificity

    • Potential applications in biocatalysis if the protein has valuable catalytic functions

  • Research tools:

    • Recombinant HI_1701 could serve as a standard for proteomic studies

    • Development as a model system for studying protein function prediction methods

    • Potential use in teaching laboratories to demonstrate protein characterization techniques

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.