Recombinant Haemophilus influenzae Uncharacterized protein HI_1737 (HI_1737)

What is the basic structure and composition of the HI_1737 protein?

HI_1737 is an uncharacterized protein from Haemophilus influenzae with UniProt ID P44301. It consists of 109 amino acids with the following sequence: MTLIEQIITIGICIVAVQFTRLLPFFVFPVNRPIPQYIRYLGKVLPPAMFGMLVVYCYKNIEI LTGYHGIPDLLAGIVVLGLHFWKKNMFLSIAVGTLFYMALVQLIFI. This full-length protein can be expressed recombinantly with an N-terminal His tag in E. coli expression systems. Physicochemical analysis suggests the protein may be membrane-associated based on its amino acid composition and hydrophobicity profile . When analyzing uncharacterized proteins like HI_1737, researchers typically employ multiple computational tools to determine conserved domains, subcellular localization, and basic structural predictions as a starting point for functional characterization .

What is currently known about the potential function of HI_1737?

As an uncharacterized protein, the specific biological function of HI_1737 remains to be fully elucidated. Computational analysis approaches would be required to predict potential functions based on sequence similarity, domain analysis, and structural prediction. Similar hypothetical proteins in other bacterial species have been analyzed using tools for identifying conserved domains, subcellular localization predictions, secretory nature, physicochemical characterization, and comparative homology analysis . When working with uncharacterized proteins, researchers should employ both computational prediction methods and experimental validation techniques to gradually build evidence for functional annotation. Initial characterization may involve examining the protein's stability, subcellular location, and potential interactions with other cellular components.

How is recombinant HI_1737 protein typically produced for research purposes?

Recombinant HI_1737 protein production typically involves expression in E. coli systems with an N-terminal His-tag for purification purposes. The full-length protein (amino acids 1-109) is expressed using recombinant DNA technology and recovered in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . For optimal expression, researchers may need to optimize codon usage for E. coli and consider strategies to prevent protein aggregation during expression. Purification typically employs affinity chromatography leveraging the His-tag, followed by additional purification steps as needed. The purified protein is generally stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, with recommendations to store at -20°C/-80°C and avoid repeated freeze-thaw cycles .

What are the optimal storage and handling conditions for recombinant HI_1737 protein?

Recombinant HI_1737 protein should be stored as a lyophilized powder at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity. For short-term storage of working solutions, store aliquots at 4°C for up to one week . When reconstituting the protein, first briefly centrifuge the vial to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (with 50% being standard) is recommended for long-term storage at -20°C/-80°C . This methodology preserves protein stability by preventing ice crystal formation that can denature proteins during freeze-thaw cycles, while the trehalose in the storage buffer serves as a cryoprotectant to maintain protein structure during freezing.

What approaches should be used to determine the subcellular localization of HI_1737?

Determining the subcellular localization of HI_1737 requires a multi-faceted approach combining computational prediction and experimental validation. For computational prediction, tools such as PSORTb can be used to classify the protein into categories like cytoplasmic, cytoplasmic membrane, extracellular, or unknown based on sequence characteristics . SignalP 5.0 server can determine whether the protein has secretory properties by identifying signal peptides . Experimentally, researchers should employ cellular fractionation techniques to separate cytoplasmic, membrane, and extracellular fractions of H. influenzae, followed by western blotting using anti-HI_1737 antibodies. Immunofluorescence microscopy using specific antibodies against HI_1737 can provide visual confirmation of localization. Additionally, fusion of HI_1737 with reporter proteins like GFP can allow for live-cell tracking of protein localization. Such comprehensive localization data is critical for forming hypotheses about the protein's potential role in bacterial physiology or pathogenesis.

What expression systems and purification strategies yield the highest quality recombinant HI_1737?

For optimal expression of recombinant HI_1737, an E. coli expression system using a T7-inducible promoter is recommended, similar to strategies employed for other H. influenzae proteins . To enhance expression and solubility, consider these methodological approaches: 1) Use BL21(DE3) or Rosetta strains to address potential codon bias issues; 2) Optimize induction conditions (IPTG concentration, temperature, and duration) - lower temperatures (16-25°C) often improve protein folding; 3) Consider fusion tags beyond His-tag, such as GST or MBP, if solubility is problematic. For purification, a two-step chromatography approach is often effective: initial purification via Ni-NTA affinity chromatography leveraging the His-tag, followed by size exclusion chromatography to achieve higher purity . If necessary, ion exchange chromatography can be added as a third step. Quality assessment should include SDS-PAGE, western blotting, mass spectrometry for identity confirmation, and dynamic light scattering to evaluate homogeneity. This systematic approach typically yields protein with >95% purity suitable for structural and functional studies.

How can computational approaches be integrated with experimental methods to predict the function of HI_1737?

A comprehensive strategy for functional prediction of HI_1737 should integrate multiple computational approaches with targeted experimental validation. Begin with sequence-based analyses including multiple sequence alignment with characterized proteins, conserved domain identification (using CDD, Pfam, SMART), and structural homology modeling. Employ specialized tools for membrane protein topology prediction if transmembrane domains are suspected. For experimental validation, consider these methodological approaches: 1) Protein-protein interaction studies using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation; 2) Phenotypic analysis of H. influenzae strains with HI_1737 deletion or overexpression; 3) Transcriptomic analysis to identify co-regulated genes, suggesting functional associations . Additional approaches include identifying potential binding partners using affinity purification coupled with mass spectrometry, metabolomic analysis to detect changes associated with gene manipulation, and interspecies complementation studies. This integrated approach provides multiple lines of evidence converging on potential functions, which is critical for uncharacterized proteins where single methods often yield ambiguous results.

What physicochemical properties of HI_1737 can provide insights into its potential biological role?

Detailed physicochemical characterization of HI_1737 can yield significant insights into its potential biological function. Key parameters to analyze include: 1) Instability index (II) - values below 40 suggest a stable protein, which appears to be characteristic of many H. influenzae hypothetical proteins; 2) Theoretical isoelectric point (pI) - which for H. influenzae hypothetical proteins typically ranges from 4.05 to 11.99; 3) GRAVY (Grand average of hydropathicity) value - negative values indicate hydrophilic nature, while positive values suggest hydrophobic characteristics . For HI_1737 specifically, analysis of its sequence reveals multiple hydrophobic regions, suggesting potential membrane association. Advanced biophysical techniques to consider include circular dichroism to determine secondary structure elements, differential scanning calorimetry to assess thermal stability and potential ligand binding, and analytical ultracentrifugation to determine oligomerization state. The presence of specific motifs or patterns of hydrophobic/hydrophilic residues may suggest functional domains, such as protein-protein interaction interfaces or small molecule binding pockets. These detailed physicochemical profiles provide crucial context for designing targeted functional experiments.

What role might HI_1737 play in H. influenzae virulence or pathogenicity?

Assessing the potential role of HI_1737 in virulence requires systematic investigation using both computational prediction and experimental validation approaches. Initially, analyze sequence homology with known virulence factors and evaluate whether HI_1737 contains domains associated with pathogenicity. Computational tools for virulence prediction can determine if HI_1737 shares characteristics with known virulence proteins in other pathogens . To experimentally investigate virulence potential, consider these methodological approaches: 1) Generate knockout mutants and assess changes in adhesion to host cells, biofilm formation, and survival under stress conditions; 2) Perform RNA-seq analysis comparing wild-type and mutant strains under infection-relevant conditions; 3) Conduct tissue culture infection models to evaluate the impact of HI_1737 deletion on host cell invasion, intracellular survival, and inflammatory response induction. Additionally, assess whether HI_1737 is upregulated during infection or under infection-relevant conditions (e.g., low pH, oxidative stress, nutrient limitation). If the protein is surface-exposed, evaluate its potential as an adhesin or invasin through direct binding assays with host components. This systematic characterization can determine whether HI_1737 represents a novel virulence determinant in H. influenzae.

What structural analysis techniques are most appropriate for characterizing HI_1737?

For comprehensive structural characterization of HI_1737, employ a multi-technique approach tailored to this 109-amino acid protein. Begin with computational structure prediction using AlphaFold or RoseTTAFold to generate initial structural models. For experimental structure determination, X-ray crystallography would be the primary choice, requiring: 1) High-purity protein (>95%) at concentrations of 5-20 mg/ml; 2) Systematic screening of crystallization conditions using commercial kits; 3) Optimization of crystal quality through additives and seeding techniques. If crystallization proves challenging, nuclear magnetic resonance (NMR) spectroscopy represents an alternative for this relatively small protein, though isotopic labeling (15N, 13C) would be required. For membrane-associated regions, circular dichroism can provide valuable secondary structure information. Hydrogen-deuterium exchange mass spectrometry can identify solvent-exposed regions and potential binding interfaces. Small-angle X-ray scattering (SAXS) can provide envelope models in solution state. For analyzing potential conformational changes upon ligand binding, molecular dynamics simulations coupled with experimental validation via fluorescence spectroscopy would be appropriate. This multi-faceted approach addresses the challenges inherent in structural characterization of uncharacterized proteins with potential membrane association.

What approaches should be used to investigate potential binding partners or substrates of HI_1737?

To comprehensively identify potential binding partners or substrates of HI_1737, employ a multi-modal approach combining biophysical techniques with functional assays. Begin with computational prediction of binding sites using tools like CASTp or FTSite to identify potential pocket regions. For experimental identification of protein binding partners, implement these methodological approaches: 1) Affinity purification coupled with mass spectrometry (AP-MS) using His-tagged HI_1737 as bait; 2) Bacterial two-hybrid or split-GFP complementation assays to detect direct protein-protein interactions; 3) Cross-linking mass spectrometry to capture transient interactions. To identify potential small molecule substrates or ligands, employ differential scanning fluorimetry (thermal shift assays) to screen compound libraries for those that stabilize HI_1737. Surface plasmon resonance or isothermal titration calorimetry can then quantify binding affinities and thermodynamic parameters for promising candidates. For functional validation, develop activity assays based on computational predictions and initial binding studies. If enzymatic activity is suspected, employ substrate screening approaches using appropriate detection methods (spectrophotometric, fluorometric, or coupled enzyme assays). This systematic approach overcomes the significant challenge of identifying binding partners for uncharacterized proteins by providing multiple lines of evidence from complementary techniques.

What challenges commonly arise during recombinant expression of HI_1737 and how can they be addressed?

Recombinant expression of HI_1737 may present several challenges requiring systematic troubleshooting. If dealing with low expression levels, optimize these parameters: 1) Codon optimization for E. coli; 2) Testing different E. coli strains (BL21(DE3), Rosetta, Arctic Express); 3) Varying IPTG concentrations (0.1-1.0 mM); 4) Adjusting induction temperature (16-37°C) and duration (3-24 hours). For protein insolubility issues, implement these methodological solutions: 1) Express as fusion with solubility-enhancing tags like MBP or SUMO; 2) Add solubility enhancers to lysis buffer (glycerol, mild detergents, increased salt); 3) Consider refolding from inclusion bodies if necessary. If protein instability is observed, modify buffer composition by testing different pH ranges (6.0-8.5), salt concentrations (100-500 mM NaCl), and adding stabilizers like glycerol (5-20%) or specific additives based on computational predictions of protein properties. For difficulties in removing the His-tag, optimize protease digestion conditions by varying enzyme concentration, temperature, and incubation time. If the protein exhibits aberrant migration on SDS-PAGE, consider potential post-translational modifications or intrinsic properties affecting mobility. For each challenge, implement a systematic optimization approach, testing multiple conditions simultaneously using small-scale expression to efficiently identify optimal parameters before scaling up.

What are the key considerations for designing experiments to determine if HI_1737 is involved in H. influenzae pathogenesis?

Designing rigorous experiments to assess HI_1737's role in pathogenesis requires a systematic approach controlling for multiple variables. Begin by generating clean deletion mutants using allelic exchange, ensuring no polar effects on adjacent genes, and complement with wild-type HI_1737 under native promoter control to confirm phenotype specificity. For in vitro pathogenesis assessments, evaluate these parameters: 1) Adhesion to relevant human cell lines (e.g., respiratory epithelial cells); 2) Biofilm formation capacity on abiotic surfaces and cell monolayers; 3) Survival under host-mimicking stress conditions (oxidative stress, nutrient limitation, antimicrobial peptides); 4) Competitive growth against wild-type in mixed cultures. For transcriptional studies, perform RNA-seq comparing wild-type and ΔHI_1737 strains under both standard and infection-relevant conditions to identify dysregulated pathways. In more advanced models, assess colonization efficiency in appropriate animal models through quantitative recovery of bacteria and competitive index calculations when co-infecting with wild-type. Importantly, incorporate appropriate controls throughout all experiments, including wild-type, mutant, and complemented strains, and use statistical approaches appropriate for biological variability. This comprehensive approach can definitively establish whether HI_1737 contributes to H. influenzae pathogenesis through direct or indirect mechanisms.

How can contradictory results in HI_1737 functional studies be reconciled and addressed?

Contradictory results in functional studies of uncharacterized proteins like HI_1737 require systematic analysis and resolution approaches. First, carefully evaluate methodological differences between studies, focusing on: 1) Strain backgrounds and potential compensatory mutations; 2) Protein expression methods and purification protocols; 3) Experimental conditions including buffer composition, temperature, and pH; 4) Detection methods and their sensitivity/specificity. When faced with contradictory data, implement these reconciliation strategies: 1) Reproduce key experiments using standardized protocols across different laboratories; 2) Employ orthogonal techniques to measure the same parameter or function; 3) Consider context-dependent protein function, as HI_1737 may have different activities under different physiological conditions. Additional approaches include: examining post-translational modifications that might explain functional differences; investigating protein-protein interactions that could modulate activity; and assessing the oligomerization state of the protein under different experimental conditions. For mechanistic understanding, integrate structural information with functional data to develop testable models explaining the apparent contradictions. Finally, recognize that proteins often have multiple functions (moonlighting), and apparent contradictions may reflect distinct activities relevant to different biological contexts. This methodical troubleshooting approach acknowledges the complex nature of protein function and builds toward a consensus understanding.

What emerging technologies show promise for elucidating the function of uncharacterized proteins like HI_1737?

Several cutting-edge technologies offer new approaches for functional characterization of proteins like HI_1737. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems adapted for bacterial systems allow for precise modulation of HI_1737 expression without complete deletion, enabling dose-dependent phenotypic analysis . High-throughput phenotypic screening using transposon sequencing (Tn-seq) can identify genetic interactions with HI_1737, revealing functional pathways. For structural characterization, cryo-electron microscopy is increasingly accessible for smaller proteins and complexes, potentially revealing structural features not captured by other methods. Protein correlation profiling using quantitative proteomics can position HI_1737 within specific subcellular compartments or functional complexes. Metabolomic profiling of wild-type versus mutant strains can identify metabolic pathways affected by HI_1737 deletion. Advanced computational approaches using machine learning algorithms trained on diverse datasets now predict protein function with improved accuracy compared to traditional sequence-based methods. Single-cell techniques adapted for bacterial systems provide insights into cell-to-cell variability in HI_1737 expression and function. Each of these advanced methodologies overcomes specific limitations of traditional approaches, enabling multi-dimensional functional characterization that would be particularly valuable for proteins resistant to conventional analysis.

How might systems biology approaches contribute to understanding the role of HI_1737 in H. influenzae physiology?

Systems biology approaches offer powerful frameworks for positioning HI_1737 within the broader functional landscape of H. influenzae. Implement these integrated methodologies: 1) Multi-omics integration combining transcriptomic, proteomic, and metabolomic data from wild-type and ΔHI_1737 strains under various conditions to identify patterns of co-regulation and metabolic perturbations; 2) Network analysis to place HI_1737 within protein-protein interaction networks and metabolic pathways, identifying functional modules; 3) Flux balance analysis incorporating HI_1737 deletion to predict metabolic consequences and generate testable hypotheses. Additional approaches include temporal dynamics studies tracking expression patterns across growth phases and stress responses, and comparative systems analysis across multiple H. influenzae strains to identify conserved functional relationships. Advanced computational modeling techniques can integrate diverse datasets to predict cellular behaviors with and without HI_1737, directing experimental validation efforts. Single-cell approaches can reveal population heterogeneity in HI_1737 expression and function. This systems-level perspective transcends traditional reductionist approaches, providing context for individual molecular functions and revealing emergent properties that might explain seemingly contradictory observations from targeted studies. The resulting integrated model would position HI_1737 within the complex adaptive network of bacterial physiology and pathogenesis.

What are the implications of functional annotation of proteins like HI_1737 for understanding bacterial evolution and adaptation?

Functional characterization of uncharacterized proteins like HI_1737 has profound implications for understanding bacterial evolution and adaptation. A comprehensive evolutionary analysis should include: 1) Phylogenetic profiling to determine the distribution of HI_1737 homologs across bacterial species, identifying patterns of conservation or horizontal gene transfer; 2) Sequence evolution analysis examining selection pressures (dN/dS ratios) acting on HI_1737 across lineages; 3) Structural homology comparison with proteins of known function to identify cases of convergent evolution or repurposing of structural scaffolds. For adaptation studies, examine expression patterns of HI_1737 under diverse environmental conditions mimicking evolutionary pressures. Assess whether HI_1737 contributes to specific adaptive traits through targeted mutation studies followed by fitness measurements under relevant selective conditions. Consider whether HI_1737 represents a species-specific innovation or an ancient conserved function, and how this impacts our understanding of H. influenzae niche adaptation. The broader significance extends to: improving genome annotation across bacterial species; identifying novel functional domains or motifs; enhancing our understanding of bacterial core and accessory genome functions; and potentially revealing new classes of bacterial proteins with unique functions. This evolutionary perspective contextualizes molecular mechanisms within the broader framework of bacterial adaptation and diversification .

Table 1: Physicochemical Properties of Recombinant HI_1737 Protein

*Based on typical values for hypothetical proteins in Haemophilus influenzae, specific values for HI_1737 may vary