Recombinant Haemophilus influenzae Uncharacterized sugar transferase HI_0872 (HI_0872)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant HI_0872 is a full-length protein (1–471 amino acids) expressed in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetail
UniProt IDQ57491
Source OrganismHaemophilus influenzae
Expression HostE. coli
Molecular Weight~53 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Context

HI_0872 is annotated as an uncharacterized sugar transferase, likely utilizing nucleotide sugar donors (e.g., UDP-glucose) to modify substrates . Glycosyltransferases in Haemophilus influenzae are implicated in processes such as:

  • Surface protein glycosylation (e.g., HMW1 adhesin, critical for epithelial cell adherence) .

  • Lipopolysaccharide (LPS) biosynthesis, influencing pathogenicity and immune evasion .

Research Applications

This recombinant protein is utilized in:

  • Enzymatic assays to study sugar transfer mechanisms.

  • Structural studies via X-ray crystallography or cryo-EM.

  • Antibody production for detecting native HI_0872 in bacterial samples.

Comparative Insights

While HI_0872 remains uncharacterized, related glycosyltransferases in Haemophilus influenzae exhibit:

FeatureHI_0872HMW1 Adhesin
FunctionPutative sugar transferaseAdhesin glycosylation
Glycosylation TypeUndeterminedN-linked (hexose/dihexose)
Subcellular LocalizationMembrane-associatedSecreted via two-partner secretion

Future Directions

Key research gaps include:

  1. Substrate Identification: Determining acceptor molecules (e.g., proteins, lipids).

  2. Mechanistic Studies: Resolving whether HI_0872 operates via retaining or inverting catalysis .

  3. Pathogenicity Link: Investigating its role in Haemophilus influenzae colonization or virulence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
HI_0872; Uncharacterized sugar transferase HI_0872
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-471
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0872
Target Protein Sequence
MNRLFFSKIALWLLDFLTFNISFLLSLFVISYYHNGYEKYLPIYEIDDRTYIHAVLAGIC VGWFAIRLRHYTYRKPFWFELKEIFRTLIIFAIFELAIVAFPKLYFSRYLWALTWGITFL LFPLARVLVKKFLIKSGWFLRDTIMIGSGDNAFDVYNALRDEPYLGFQVTHFISVSNISN NVKELNIPILNSMSSWTSVTKKTDQFIIALEDDEEVDRNNWLRYFSTNGYRSVSVIPTLR GLPLYNTDMSFMFSHEIMLLQMNNNLAKLSSRILKRTMDIVVGSLAIIIFSPVLLYLYFA VKKDGGNAIYGHPRIGRNGKTFNCLKFRTMAVNSKEVLDELLRTDPEARAEWEKDFKLKN DPRITKIGAFIRKTSLDELPQLFNVLKGEMSLVGPRPIVIDELERYEENVDYYLMARPGM TGLWQVSGRNNIDYNTRVYFDSWYVKNWSLWNDIAILFKTMNVVLNRDGAY
Uniprot No.

Target Background

Function
May function as a sugar transferase.
Database Links

KEGG: hin:HI0872

STRING: 71421.HI0872

Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HI_0872 and what is its predicted function?

HI_0872 is an uncharacterized sugar transferase from Haemophilus influenzae with a predicted function in lipopolysaccharide (LPS) biosynthesis. It belongs to a locus containing several LPS-related genes identified through genome sequence analysis . The protein has 471 amino acids and is thought to participate in the transfer of sugar moieties during the assembly of bacterial cell surface structures.

The gene encoding HI_0872 is part of a genomic region with a distinctly lower G+C content (approximately 30%) compared to the H. influenzae genome average of 38.2%, suggesting possible acquisition through horizontal gene transfer . While its precise biochemical function remains to be fully characterized, its homology and genomic context suggest involvement in cell surface glycosylation pathways that may contribute to bacterial virulence and host interaction mechanisms.

How is recombinant HI_0872 typically expressed and purified?

Recombinant HI_0872 is commonly expressed as a His-tagged fusion protein in Escherichia coli expression systems. The typical methodology involves:

  • Expression Vector Selection: Vectors containing an N-terminal His-tag (usually 6× or 9× histidine) are preferred for efficient purification .

  • Host Cell Optimization: E. coli strains optimized for membrane or difficult protein expression are recommended, as HI_0872 contains transmembrane domains that can complicate expression .

  • Induction Conditions: Expression is typically induced with IPTG at reduced temperatures (16-25°C) to improve protein folding.

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) is the primary purification method

    • Cell lysis in Tris-based buffers containing mild detergents

    • Elution with imidazole gradient

    • Further purification by size exclusion chromatography if needed

  • Storage Formulation: Purified protein is typically stored in Tris/PBS-based buffer with 6-50% trehalose or glycerol at pH 8.0 to maintain stability .

The resulting protein preparations typically achieve >90% purity as determined by SDS-PAGE analysis .

How does HI_0872 compare with characterized sugar transferases in other bacteria?

HI_0872 belongs to a family of bacterial sugar transferases but remains relatively uncharacterized compared to well-studied homologs. Key comparative findings include:

FeatureHI_0872Other Bacterial Sugar Transferases
Substrate SpecificityUnknown; predicted to use UDP-activated sugarsOften specific for particular sugar-nucleotide donors
Catalytic MechanismPredicted retaining mechanism similar to GH1 familyCan be either retaining or inverting depending on family
LocalizationPredicted membrane associationMany are cytoplasmic; some are membrane-associated
Role in PathogenesisPotentially involved in LPS modificationOften critical for virulence and host evasion
HomologyShows low homology to WaaL (O-antigen ligase) Many characterized in detail with known structures
ConservationFound in H. influenzae strainsRelated transferases widely distributed in gram-negative bacteria

Unlike many well-characterized sugar transferases such as those in the AsTG1 system from oats that have defined roles in biosynthetic pathways , HI_0872 remains functionally enigmatic. The protein shows some sequence similarity to enzymes involved in O-antigen biosynthesis, suggesting a potential role in cell surface glycoconjugate assembly.

What are appropriate experimental controls when working with recombinant HI_0872?

When designing experiments with recombinant HI_0872, appropriate controls are essential to ensure valid interpretation of results:

Recommended Experimental Controls:

  • Expression Controls:

    • Empty vector expression (negative control)

    • Well-characterized His-tagged protein of similar size (expression efficiency control)

    • Western blot with anti-His antibodies to confirm expression

  • Purification Controls:

    • Non-induced culture sample (background protein control)

    • Sequential elution fractions to track purification efficiency

    • Size exclusion chromatography to assess protein aggregation state

  • Activity Assay Controls:

    • Heat-inactivated HI_0872 (negative enzymatic control)

    • Known glycosyltransferase with similar predicted function (positive control)

    • Substrate-only and enzyme-only reactions (background reaction controls)

    • Testing with multiple potential sugar donors (UDP-glucose, UDP-galactose, etc.)

  • Stability Controls:

    • Fresh vs. stored protein preparation comparison

    • Multiple freeze-thaw cycles assessment to determine stability

    • Different buffer conditions to optimize storage

  • Specificity Controls:

    • Related but distinct sugar transferases to establish specificity

    • Mutated substrate analogs to determine binding requirements

    • Competition assays with predicted similar substrates

Proper implementation of these controls helps distinguish genuine enzymatic activity from artifacts and establishes a reliable experimental framework for characterizing this uncharacterized protein.

What methodologies are most effective for determining the substrate specificity of HI_0872?

Determining the substrate specificity of uncharacterized sugar transferases like HI_0872 requires a multi-faceted approach combining biochemical, analytical, and structural methods:

  • In vitro Glycosyltransferase Assays:

    • Radiometric Assays: Using radiolabeled nucleotide-sugar donors (typically UDP-[14C]glucose or UDP-[3H]glucose) to detect transfer to potential acceptors

    • Colorimetric/Fluorometric Assays: Employing coupled enzyme systems that detect released UDP

    • HPLC-MS Analysis: Monitoring substrate conversion and product formation through analytical separation and mass detection, similar to approaches used for AsUGT91G16

  • Substrate Library Screening:

    • Testing arrays of potential acceptor molecules including:

      • LPS core fragments

      • Synthetic oligosaccharides

      • Fluorescently-labeled glycan acceptors

    • Examining various nucleotide-sugar donors (UDP-glucose, UDP-galactose, etc.)

  • Transglycosylation Activity Assessment:

    • Testing whether HI_0872 can function like AsTG1 in using alternative sugar donors

    • Employing model substrates like 4-nitrophenyl β-d-glucose (4NPGlc) to assess transglycosylation versus hydrolysis activities

  • Heterologous Expression Systems:

    • Expression in Nicotiana benthamiana (tobacco) for in vivo activity assessment

    • Co-expression with other glycosyltransferases to reconstitute potential biosynthetic pathways

    • Complementation studies in knockout mutants

  • Structural Biology Approaches:

    • Co-crystallization with substrate analogs

    • Molecular docking simulations

    • Site-directed mutagenesis of predicted catalytic residues

Each approach has strengths and limitations, and researchers should employ multiple complementary methods to build a comprehensive understanding of HI_0872 substrate specificity.

What is the potential role of HI_0872 in Haemophilus influenzae pathogenesis?

The role of HI_0872 in H. influenzae pathogenesis likely involves modulation of cell surface structures that interact with host defenses, though direct evidence remains limited:

  • LPS Modification and Host Immune Evasion:

    • Sugar transferases often contribute to LPS heterogeneity, creating "cryptic" glycoforms that may help evade host immunity

    • The hmg locus containing HI_0872 may contribute to phase variation in LPS structure, a known virulence mechanism in H. influenzae

  • Biofilm Formation:

    • Cell surface glycoconjugates mediated by sugar transferases often play crucial roles in biofilm formation

    • H. influenzae biofilms are important in infections like otitis media and contribute to persistence in cystic fibrosis airways

  • Antibiotic Resistance:

    • Modifications to cell surface structures can affect permeability to antimicrobials

    • Given increasing β-lactam resistance through PBP alterations in H. influenzae , cell wall modifications may have compounding effects

  • Host Colonization:

    • Sugar transferases often contribute to adhesion mechanisms

    • As nontypeable H. influenzae has become more prevalent in the post-Hib vaccine era , novel colonization factors may be increasingly important

  • Relation to Vaccine Development:

    • Understanding sugar transferases like HI_0872 could inform development of vaccines against nontypeable H. influenzae

    • Surface glycoconjugates often represent potential vaccine targets

The high-throughput insertion tracking by deep sequencing (HITS) methodology has been employed to identify genes essential for H. influenzae survival in infection models . Application of this approach to studying HI_0872 could provide direct evidence of its role in pathogenesis.

How can gene knockout and complementation studies best elucidate HI_0872 function?

Systematic gene knockout and complementation studies represent powerful approaches for elucidating HI_0872 function:

Recommended Methodology:

  • Precise Gene Deletion:

    • Construction of markerless, in-frame deletion mutants using homologous recombination

    • Creation of conditional mutants if HI_0872 is potentially essential

    • Development of complementation constructs with native and epitope-tagged versions

  • Phenotypic Characterization:

    • Comprehensive LPS Analysis:

      • Silver staining of LPS preparations

      • Mass spectrometry characterization of LPS structures

      • Immunoblotting with monoclonal antibodies against specific LPS epitopes

    • Growth and Stress Response:

      • Growth curves under various conditions

      • Sensitivity to antimicrobial peptides, detergents, and antibiotics

      • Survival under oxidative and pH stress

    • Host Interaction Studies:

      • Adhesion and invasion assays with relevant cell lines

      • Biofilm formation capacity

      • Serum resistance testing

  • Animal Infection Models:

    • Murine pulmonary infection model established for H. influenzae

    • Chinchilla model of otitis media

    • Tracking bacterial burden and host responses

    • Competition assays between wild-type and mutant strains

  • High-Throughput Methods:

    • Application of the HITS methodology to study the significance of HI_0872 in various niches

    • Transcriptomic profiling of the knockout strain

    • Metabolomic analysis focusing on cell wall precursors

  • Complementation Analysis:

    • Trans-complementation: Reintroduction of HI_0872 at a neutral site

    • Cis-complementation: Restoration of the gene in its native locus

    • Heterologous complementation: Testing whether sugar transferases from other species can restore function

These approaches should be integrated with biochemical characterization to establish definitive links between enzymatic activity and biological function.

What structural biology approaches are most promising for characterizing HI_0872?

Several structural biology approaches offer promising avenues for characterizing HI_0872, each with specific advantages:

The optimal approach would likely combine computational modeling with targeted experimental validation, followed by high-resolution structural determination once expression and purification conditions are optimized.

How can high-throughput screening approaches identify inhibitors of HI_0872?

Development of high-throughput screening (HTS) approaches for HI_0872 inhibitors requires careful assay design and validation:

  • Primary Assay Development:

    • Fluorescence-Based Assays:

      • UDP-Glo™ assay to detect released UDP from sugar-nucleotide donors

      • FRET-based assays using labeled acceptor substrates

      • Fluorescently labeled substrate analogs

    • Colorimetric Assays:

      • Malachite green assay for phosphate release (coupled assay)

      • Tetrazolium-based redox assays for coupled enzyme reactions

  • Assay Optimization and Validation:

    • Determination of optimal enzyme concentration and reaction time

    • DMSO tolerance testing

    • Statistical validation: Z' factor >0.5 for robustness

    • Positive controls: Known glycosyltransferase inhibitors as benchmark

  • Compound Library Selection:

    • Focused libraries targeting sugar-nucleotide binding pockets

    • Natural product libraries (bacterial secondary metabolites)

    • Fragment-based approaches for initial hits

    • Virtual screening pre-filtering

  • Counter-screening and Selectivity:

    • Testing against related sugar transferases

    • Mammalian glycosyltransferase counter-screens

    • Cell toxicity assessment

  • Hit Validation and Characterization:

    • Dose-response relationships

    • Mechanism of inhibition studies

    • Binding affinity determination (ITC, SPR)

    • Structural studies of enzyme-inhibitor complexes

  • Cell-Based Secondary Assays:

    • Impact on H. influenzae growth

    • Effects on LPS structure

    • Biofilm formation inhibition

    • Potentiation of antibiotic activity

  • In Silico Support:

    • Molecular docking of hits

    • Structure-activity relationship analysis

    • Pharmacophore modeling for hit expansion

This systematic approach would enable identification of HI_0872 inhibitors that could serve as both chemical probes to study enzyme function and potential starting points for antimicrobial development.

What is the evolutionary significance of HI_0872 in bacterial adaptation?

The evolutionary context of HI_0872 provides insights into its biological significance and potential functions:

  • Genomic Context and Horizontal Gene Transfer:

    • HI_0872 is located in the hmg locus with a G+C content of approximately 30%, significantly lower than the H. influenzae genome average of 38.2%

    • This suggests acquisition through horizontal gene transfer, potentially conferring adaptive advantages

  • Phylogenetic Distribution:

    • Analysis of HI_0872 homologs across bacterial species reveals:

      • Core presence in H. influenzae strains

      • Variable distribution in related Pasteurellaceae

      • Distant homologs in other gram-negative pathogens

    • This pattern suggests specialized functions potentially related to niche adaptation

  • Selective Pressures:

    • Cell surface modifications often evolve under selective pressure from:

      • Host immune systems

      • Bacteriophage predation

      • Competition with other microorganisms

    • The maintenance of HI_0872 in H. influenzae genomes suggests functional importance

  • Structural Adaptation:

    • Comparative analysis with characterized sugar transferases can reveal:

      • Conserved catalytic residues indicating enzymatic mechanism

      • Variable regions potentially involved in substrate specificity

      • Structural adaptations for membrane association

  • Role in Phase Variation:

    • Many surface-modifying enzymes in H. influenzae are subject to phase variation

    • This mechanism creates phenotypic diversity within bacterial populations

    • Phase variation in LPS structure contributes to immune evasion and adaptation to changing environments

  • Impact of Vaccination:

    • With the shift from Hib to nontypeable H. influenzae in the post-vaccine era , proteins involved in surface modification may have increased evolutionary significance

    • Understanding the role of HI_0872 could provide insights into bacterial adaptation following vaccine pressure

Evolutionary analysis of HI_0872 offers valuable context for understanding its biological role and potential significance in bacterial adaptation and pathogenesis.

What methodologies can effectively determine the expression patterns of HI_0872 during infection?

Understanding the expression patterns of HI_0872 during infection requires specialized approaches that can detect gene and protein expression in complex host environments:

  • Transcriptomic Approaches:

    • RNA-Seq from Infection Models:

      • Direct RNA extraction from infected tissues

      • Dual RNA-Seq to simultaneously profile host and pathogen

      • Enrichment methods for bacterial transcripts

    • qRT-PCR with Specific Primers:

      • Targeted approach for specific time points

      • Requires careful normalization with reference genes

      • Can be applied to samples with limited bacterial RNA

    • In vivo Expression Technology (IVET):

      • Promoter trap approach to identify genes expressed during infection

      • Selection for promoters active in vivo but not in vitro

  • Protein-Level Detection:

    • Custom Antibodies Against HI_0872:

      • Western blotting from infection samples

      • Immunohistochemistry on tissue sections

      • Flow cytometry of recovered bacteria

    • Tagged Protein Approaches:

      • Chromosomal integration of epitope-tagged HI_0872

      • Luciferase or fluorescent protein reporters

      • FRET-based biosensors for protein activity

  • Single-Cell Approaches:

    • Single-Cell RNA-Seq:

      • Captures expression heterogeneity in bacterial populations

      • Can identify subpopulations with distinct expression profiles

    • Fluorescent Reporters with Microscopy:

      • Direct visualization of expression in tissue context

      • Time-lapse imaging for dynamic expression patterns

  • Systems Biology Integration:

    • Multi-omics Integration:

      • Correlation of transcriptomics, proteomics, and metabolomics data

      • Network analysis of co-expressed genes

    • Computational Modeling:

      • Prediction of expression based on regulatory networks

      • Machine learning approaches to identify expression patterns

  • High-Throughput Mutation Analysis:

    • The HITS methodology previously applied to H. influenzae can be modified to study gene expression patterns

    • TraDIS-Xpress combines transposon insertion sequencing with transcriptomics

These methodologies can be applied across different infection models, time points, and conditions to build a comprehensive picture of HI_0872 expression patterns and regulation during infection.

What are the critical quality control parameters for recombinant HI_0872 protein preparations?

Ensuring consistent quality of recombinant HI_0872 preparations is essential for reliable experimental results. Key quality control parameters include:

Quality Control ParameterAcceptance CriteriaRecommended Methods
Purity>90%SDS-PAGE with densitometry, Size-exclusion HPLC
IdentityMatches expected sequenceMass spectrometry, Western blot with anti-His antibodies
ConcentrationAccurate within ±10%Bradford/BCA assay, UV absorption (A280)
Endotoxin Content<1.0 EU/mg proteinLAL assay
Aggregation StatePredominantly monomericDynamic light scattering, SEC-MALS
Secondary StructureConsistent with predictionsCircular dichroism spectroscopy
StabilityMaintains activity for ≥7 days at 4°CActivity assays at defined timepoints
Freeze-Thaw Stability<20% activity loss after 3 cyclesComparative activity testing
Host Cell Protein<100 ppmELISA with anti-E. coli antibodies
Host Cell DNA<10 ng/mg proteinqPCR

Additional specialized assessments may include:

  • Functional Activity:

    • Development of a specific activity assay once substrates are identified

    • Comparison to reference standard across batches

  • Thermal Stability:

    • Differential scanning fluorimetry (DSF)

    • Determination of melting temperature (Tm)

  • Post-Translational Modifications:

    • Phosphorylation status

    • Glycosylation analysis if applicable

  • Buffer Compatibility:

    • Testing stability in various buffer conditions

    • Determination of optimal pH and ionic strength

Implementing these quality control measures ensures that experimental variations are due to biological phenomena rather than inconsistencies in protein preparation.

How can researchers effectively address the challenges of membrane association when working with HI_0872?

The predicted membrane association of HI_0872 presents specific challenges for expression, purification, and functional characterization. Effective strategies include:

  • Expression Optimization:

    • Specialized E. coli Strains:

      • C41(DE3) or C43(DE3) designed for membrane protein expression

      • Tuner™ strains for control of expression level

      • Strains with enhanced membrane capacity

    • Expression Constructs:

      • Testing N-terminal vs. C-terminal tags

      • Creation of truncated constructs without transmembrane regions

      • Fusion partners that enhance solubility (MBP, SUMO)

    • Induction Conditions:

      • Low IPTG concentrations (0.1-0.5 mM)

      • Reduced temperature (16-20°C)

      • Extended expression periods (24-48 hours)

  • Membrane Protein Extraction:

    • Detergent Screening:

      • Mild detergents (DDM, LMNG, OG)

      • Native membrane mimetics (nanodiscs, SMALPs)

      • Systematic screening of detergent combinations

    • Solubilization Conditions:

      • Optimization of pH, salt concentration

      • Addition of glycerol or stabilizing agents

      • Detergent concentration gradient testing

  • Alternative Expression Systems:

    • Cell-Free Expression:

      • Direct incorporation into liposomes or nanodiscs

      • Control over membrane-mimetic environment

    • Eukaryotic Expression:

      • Yeast (Pichia pastoris)

      • Insect cells (Sf9, High Five™)

      • Mammalian cells for complex post-translational modifications

  • Functional Characterization:

    • Reconstitution Systems:

      • Proteoliposomes

      • Supported lipid bilayers

      • Droplet interface bilayers

    • Surface Plasmon Resonance (SPR):

      • Capture on sensor chips via His-tag

      • Direct analysis of substrate interactions

  • Structural Approaches:

    • Crystallization Strategies:

      • Lipidic cubic phase (LCP) crystallization

      • Co-crystallization with antibody fragments

      • Detergent screening matrix

    • Cryo-EM:

      • Analysis in detergent micelles or nanodiscs

      • 2D crystallization in lipid bilayers

By systematically addressing these challenges, researchers can overcome the difficulties associated with membrane proteins and establish reliable systems for studying HI_0872.

What are the best approaches for detecting sugar transferase activity in complex biological samples?

Detecting sugar transferase activity in complex biological samples requires sensitive and specific analytical techniques:

  • Activity-Based Protein Profiling (ABPP):

    • Development of activity-based probes for glycosyltransferases

    • Click chemistry approaches for probe attachment

    • Enrichment and identification of active enzymes

  • Metabolic Labeling:

    • Incorporation of azide or alkyne-modified sugar precursors

    • Bioorthogonal conjugation for visualization or enrichment

    • Mass spectrometry analysis of labeled glycoconjugates

  • Mass Spectrometry-Based Methods:

    • Multiple Reaction Monitoring (MRM):

      • Targeted analysis of specific glycoconjugates

      • High sensitivity and specificity

      • Absolute quantification with internal standards

    • Untargeted Glycomics:

      • Comprehensive analysis of glycan structures

      • Comparison between wild-type and mutant samples

      • Integration with proteomics data

  • Immunological Methods:

    • Glycan-Specific Antibodies:

      • Development of antibodies against specific glycan structures

      • ELISA or Western blot detection

      • Immunofluorescence microscopy

    • Lectin-Based Detection:

      • Panels of lectins with defined specificities

      • Microarray formats for high-throughput analysis

      • Flow cytometry for cell surface analysis

  • Chromatographic Methods:

    • HPLC with Multiple Detection Methods:

      • UV detection for proteins

      • Fluorescence for labeled glycans

      • Mass spectrometry for structure identification

    • Capillary Electrophoresis:

      • High-resolution separation of complex mixtures

      • Minimal sample requirements

      • Compatible with various detection methods

  • Enzymatic Activity Assays:

    • Coupled Enzyme Assays:

      • Detection of UDP release through auxiliary enzymes

      • Continuous monitoring of activity

      • Adaptable to high-throughput formats

    • Radiometric Assays:

      • Transfer of radiolabeled sugars

      • High sensitivity but lower throughput

      • Requires special handling and disposal

These approaches can be combined and adapted to specific experimental contexts, enabling detection of sugar transferase activity even in complex biological matrices such as bacterial lysates, infected tissues, or clinical samples.

How can researchers effectively distinguish between the functions of HI_0872 and other LPS-related genes in H. influenzae?

Distinguishing between the functions of HI_0872 and other LPS-related genes requires careful experimental design and multiple complementary approaches:

  • Combinatorial Genetics:

    • Single and Multiple Gene Deletions:

      • Creation of a panel of single gene knockouts

      • Construction of double and triple mutants

      • Systematic phenotypic analysis

    • Complementation Studies:

      • Cross-complementation between related genes

      • Domain swapping experiments

      • Heterologous expression of orthologous genes

  • Biochemical Characterization:

    • Substrate Specificity Profiling:

      • Comparison of substrate utilization patterns

      • Competition assays with shared substrates

      • Kinetic parameters (Km, Vmax, kcat)

    • Enzyme Mechanism Studies:

      • Determination of reaction stereochemistry

      • Identification of catalytic residues

      • Inhibitor sensitivity patterns

  • Structural Analysis of LPS:

    • Mass Spectrometry:

      • High-resolution MS/MS analysis

      • Comparative glycomics between mutants

      • Isotope labeling to track specific modifications

    • NMR Spectroscopy:

      • Detailed structural characterization

      • Assignment of linkage types and anomeric configurations

      • Comparison between wild-type and mutant structures

  • Temporal Expression Analysis:

    • Time-Course Studies:

      • Determination of expression patterns during growth

      • Analysis of expression during infection

      • Response to environmental stimuli

    • Regulatory Studies:

      • Identification of transcription factors

      • Characterization of promoter elements

      • Epigenetic regulation mechanisms

  • Protein-Protein Interaction Studies:

    • Co-Immunoprecipitation:

      • Identification of interaction partners

      • Assembly of enzyme complexes

      • Co-localization studies

    • Bacterial Two-Hybrid Screens:

      • Systematic analysis of protein interactions

      • Identification of functional complexes

      • Mapping of interaction domains

  • Functional Genomics Approaches:

    • Synthetic Genetic Arrays:

      • Identification of genetic interactions

      • Pathway mapping through epistasis analysis

      • Suppressor screens

    • Transposon Sequencing:

      • Identification of genes with related functions

      • Synthetic lethal interactions

      • Conditional essentiality

By integrating these approaches, researchers can develop a comprehensive understanding of the specific roles of HI_0872 in relation to other LPS-related genes, revealing both unique functions and potential redundancies or synergies.

How might HI_0872 contribute to novel antimicrobial development strategies?

Understanding HI_0872 could inform several antimicrobial development strategies targeting H. influenzae and potentially other gram-negative pathogens:

  • Direct Enzymatic Inhibition:

    • Development of specific HI_0872 inhibitors that disrupt LPS biosynthesis

    • Design of transition state analogs based on the enzymatic mechanism

    • Structure-based drug design once protein structure is resolved

  • Antivirulence Approaches:

    • Targeting surface structures without direct bactericidal effects

    • Attenuation of pathogenicity rather than growth inhibition

    • Potentially lower selective pressure for resistance development

  • Vaccine Development:

    • Identification of conserved glycan epitopes as vaccine targets

    • Understanding surface glycoconjugate variation to develop broadly protective vaccines

    • Development of glycoconjugate vaccines incorporating relevant epitopes

  • Sensitization Strategies:

    • LPS modifications often contribute to antimicrobial resistance

    • Inhibitors of HI_0872 might sensitize bacteria to existing antibiotics

    • Combination therapy approaches targeting cell envelope biogenesis

  • Diagnostic Applications:

    • Identification of specific glycan structures as biomarkers

    • Development of rapid diagnostic tests based on surface glycan profiles

    • Distinction between typeable and non-typeable H. influenzae strains

  • Host-Targeted Approaches:

    • Blocking host receptors that interact with bacterial glycoconjugates

    • Modulation of host glycosyltransferases that may interact with bacterial structures

    • Enhancement of innate immune recognition of modified surface structures

The increasing prevalence of non-typeable H. influenzae infections in the post-Hib vaccine era and the emergence of antimicrobial resistance underscore the importance of novel therapeutic approaches targeting surface structure biosynthesis.

What are the most promising techniques for studying glycosyltransferase mechanisms in membrane-associated enzymes?

Studying glycosyltransferase mechanisms in membrane-associated enzymes like HI_0872 requires specialized techniques that can accommodate the membrane environment:

  • Advanced Spectroscopic Methods:

    • Site-Directed Spin Labeling with EPR:

      • Introduction of nitroxide spin labels at specific positions

      • Analysis of local dynamics and conformational changes

      • Compatible with membrane environments

    • Solid-State NMR:

      • Analysis of proteins in native-like membrane environments

      • Determination of structure and dynamics

      • Observation of substrate interactions

    • Time-Resolved Fluorescence:

      • FRET-based approaches to track domain movements

      • Analysis of enzyme-substrate interactions

      • Determination of reaction kinetics

  • Single-Molecule Techniques:

    • Atomic Force Microscopy (AFM):

      • Direct visualization of membrane-embedded proteins

      • Force measurements of substrate binding

      • Observation of conformational changes

    • Single-Molecule FRET:

      • Detection of conformational changes during catalysis

      • Identification of rare or transient states

      • Analysis of reaction pathways

  • Native Mass Spectrometry:

    • Nanodiscs with Mass Spectrometry:

      • Analysis of intact membrane protein complexes

      • Detection of non-covalent interactions

      • Observation of substrate binding

    • Hydrogen-Deuterium Exchange MS:

      • Mapping of solvent accessibility

      • Identification of conformational changes

      • Compatible with detergent-solubilized proteins

  • Cryo-EM Approaches:

    • Time-Resolved Cryo-EM:

      • Capturing catalytic intermediates

      • Visualization of enzyme-substrate complexes

      • Multiple conformational states

    • Electron Crystallography:

      • 2D crystals in lipid bilayers

      • High-resolution structural determination

      • Native-like membrane environment

  • Computational Methods:

    • Molecular Dynamics Simulations:

      • Explicit membrane simulations

      • Free energy calculations for substrate binding

      • Reaction mechanism modeling

    • Quantum Mechanics/Molecular Mechanics (QM/MM):

      • Detailed analysis of reaction mechanisms

      • Energy profiles for catalytic steps

      • Electronic structure calculations

  • High-Throughput Mutagenesis:

    • Deep Mutational Scanning:

      • Comprehensive analysis of sequence-function relationships

      • Identification of catalytic residues

      • Mapping of substrate specificity determinants

These advanced techniques provide complementary information about enzyme mechanism and can overcome the challenges associated with studying membrane-associated glycosyltransferases.

What are the current limitations in our understanding of HI_0872 and how might they be addressed?

Despite the available information, significant gaps remain in our understanding of HI_0872. Key limitations and approaches to address them include:

  • Functional Characterization:

    • Limitation: The precise enzymatic activity and substrates remain unknown

    • Approach: Systematic screening of potential sugar donors and acceptors using sensitive analytical methods like HPLC-MS

    • Challenge: Obtaining appropriate substrate candidates, especially if they are complex LPS intermediates

  • Structural Information:

    • Limitation: No high-resolution structure is available

    • Approach: Optimization of expression and purification for structural biology, potentially using truncated constructs

    • Challenge: Membrane association may complicate structural determination

  • In vivo Role:

    • Limitation: The contribution to bacterial physiology and pathogenesis is poorly defined

    • Approach: Generation of knockout mutants and comprehensive phenotypic characterization

    • Challenge: Potential functional redundancy with other glycosyltransferases

  • Expression and Regulation:

    • Limitation: Limited understanding of when and how HI_0872 is expressed

    • Approach: Transcriptomic and proteomic analysis under various conditions, including during infection

    • Challenge: Low expression levels or condition-specific expression

  • Evolutionary Context:

    • Limitation: Incomplete understanding of conservation and selection pressures

    • Approach: Comprehensive phylogenetic analysis across bacterial species with functional validation

    • Challenge: Annotation inconsistencies in bacterial genomes

  • Interaction Partners:

    • Limitation: Unknown protein-protein interactions that may be essential for function

    • Approach: Affinity purification coupled with mass spectrometry or bacterial two-hybrid screening

    • Challenge: Preserving transient or membrane-dependent interactions

  • Technical Limitations:

    • Limitation: Difficulty in expressing and purifying active enzyme

    • Approach: Exploration of alternative expression systems, including cell-free systems

    • Challenge: Maintaining native conformation and enzymatic activity

  • Translation to Therapeutic Applications:

    • Limitation: Unclear relevance as a therapeutic target

    • Approach: Validation studies in infection models with conditional mutants or specific inhibitors

    • Challenge: Demonstrating essentiality or significant contribution to virulence

Addressing these limitations requires a multidisciplinary approach combining biochemistry, structural biology, genetics, and infection biology to develop a comprehensive understanding of this uncharacterized sugar transferase.

How can systems biology approaches contribute to understanding the role of HI_0872 in bacterial physiology?

Systems biology provides powerful frameworks for understanding HI_0872 within the broader context of bacterial physiology:

  • Multi-omics Integration:

    • Transcriptomics: RNA-Seq analysis of HI_0872 mutants to identify compensatory responses

    • Proteomics: Quantitative proteomics to detect changes in protein expression and post-translational modifications

    • Metabolomics: Analysis of metabolic changes, particularly in cell envelope components

    • Glycomics: Comprehensive analysis of glycan structures affected by HI_0872

    • Integration of these datasets to create a holistic view of HI_0872's impact

  • Network Analysis:

    • Protein-Protein Interaction Networks:

      • Identification of functional modules

      • Positioning of HI_0872 within cellular pathways

      • Detection of hub proteins and essential interactions

    • Gene Regulatory Networks:

      • Identification of transcription factors controlling HI_0872

      • Mapping of regulatory cascades

      • Feedback mechanisms and control circuits

  • Genome-Scale Modeling:

    • Flux Balance Analysis:

      • Integration of HI_0872 into genome-scale metabolic models

      • Prediction of metabolic consequences of gene deletion

      • Identification of synthetic lethal interactions

    • Whole-Cell Modeling:

      • Incorporation of LPS biosynthesis pathways

      • Prediction of phenotypic outcomes

      • Simulation of environmental perturbations

  • High-Throughput Phenotyping:

    • Phenotype Microarrays:

      • Testing growth under hundreds of conditions

      • Identification of condition-specific requirements

      • Comparative analysis of wild-type and mutant strains

    • Chemical Genomics:

      • Screening for compound-specific sensitivity

      • Identification of pathways linked to HI_0872 function

      • Drug-target interaction networks

  • Comparative Systems Biology:

    • Cross-Species Analysis:

      • Comparison with related enzymes in other bacteria

      • Evolutionary conservation of network properties

      • Identification of species-specific adaptations

    • Pan-Genome Analysis:

      • Distribution across H. influenzae isolates

      • Correlation with other genomic features

      • Association with specific pathotypes

  • In silico Prediction and Validation:

    • Hypothesis Generation:

      • Computational prediction of HI_0872 function

      • Simulation of system-wide effects

      • Prioritization of experimental validation

    • Model Refinement:

      • Iterative improvement based on experimental data

      • Integration of new knowledge

      • Development of predictive models

The HITS methodology previously applied to H. influenzae represents a systems-level approach that could be extended to study HI_0872 in various contexts, providing insights into its role within the broader bacterial physiological network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.