Recombinant Haemophilus influenzae Uncharacterized transporter HI_0976.1 (HI_0976.1)

What is HI_0976.1 and how is it classified structurally?

HI_0976.1 is an uncharacterized membrane transporter protein from Haemophilus influenzae. Based on sequence analysis, it belongs to the Major Facilitator Superfamily (MFS) of transporters, which constitutes the largest and most diverse known superfamily of secondary transporters widely distributed throughout all domains of life . The protein consists of 170 amino acids with the sequence: MAFIGVAILINGGKNNEGIDNISLFGCLLVLSAGIIFAAVLRWTQRVVAKVSTQAYTSVS IVLGTITTLPFTLLLTENWQISLNSTGIAGLLYLAIGCSWLAYWLWNKGLNSVDANISGV LVALEPLFGILFAVSLLGETLSFSAALGITIIMLATLGSTLLPKLLKKSV . Like many MFS transporters, HI_0976.1 likely contains multiple transmembrane segments, as MFS proteins typically possess 12, 14, or occasionally 24 transmembrane domains .

How is recombinant HI_0976.1 produced for research purposes?

Recombinant HI_0976.1 protein is produced by expressing the full-length gene sequence (encoding amino acids 1-170) in Escherichia coli expression systems. The protein is commonly fused with an N-terminal histidine tag to facilitate purification . Following expression, the protein is purified, likely through affinity chromatography utilizing the His-tag, and prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant HI_0976.1 protein?

For long-term storage, recombinant HI_0976.1 should be stored at -20°C to -80°C, with aliquoting being necessary for multiple uses to avoid freeze-thaw cycles which can compromise protein integrity . The recommended reconstitution protocol involves:

• Brief centrifugation of the vial before opening

• Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

• Aliquoting for long-term storage at -20°C/-80°C

For short-term storage, working aliquots can be kept at 4°C for up to one week, but repeated freezing and thawing should be avoided .

What functional predictions can be made about HI_0976.1 based on its sequence homology to characterized MFS transporters?

While HI_0976.1 remains uncharacterized, sequence analysis and comparison with other MFS transporters suggest potential functions. The MFS superfamily includes transporters that function as uniporters (transporting one substrate down its concentration gradient), symporters (simultaneously translocating multiple substrates in the same direction), or antiporters (transporting substrates in opposite directions across the membrane) .

Based on studies of other previously uncharacterized MFS transporters, HI_0976.1 may function similarly to characterized members like MdrP from Planococcus maritimus, which demonstrates dual functionality as both a Na⁺(Li⁺,K⁺)/H⁺ antiporter and a multidrug efflux pump . The presence of specific signature motifs in the protein sequence would be indicative of its functional class within the MFS superfamily. For instance, the presence of a signature Motif A with consensus sequence GxLaDrxGrkxxl (where x represents any amino acid, and capital and lowercase letters represent amino acid frequency of >70% and 40-70%, respectively) would suggest classification within the Drug/H⁺ antiporter (DHA) family .

How might researchers determine the substrate specificity of HI_0976.1?

Determining the substrate specificity of an uncharacterized transporter like HI_0976.1 requires a multi-faceted experimental approach:

• Heterologous Expression Systems: Express HI_0976.1 in model organisms lacking endogenous transporters with similar function. For example, researchers could use E. coli KNabc strains (deficient in major Na⁺/H⁺ antiporters) to test for Na⁺/H⁺ antiport activity .

• Transport Assays: Measure the movement of potential substrates in membrane vesicles prepared from cells expressing HI_0976.1. For cation transport activity, this could involve monitoring pH changes using acridine orange fluorescence quenching assays .

• Minimum Inhibitory Concentration (MIC) Tests: If HI_0976.1 functions as a drug efflux pump, researchers can conduct MIC tests with various antimicrobial compounds in strains expressing or lacking the transporter .

• Drug Efflux Activity Assays: Direct measurement of substrate efflux using fluorescent dyes (like ethidium bromide or Hoechst 33342) that change fluorescence properties upon cellular accumulation or efflux .

• Site-Directed Mutagenesis: Mutation of conserved residues predicted to be involved in substrate binding or transport mechanism to identify critical functional domains.

What experimental approaches can address the physiological role of HI_0976.1 in Haemophilus influenzae?

Understanding the physiological role of HI_0976.1 in its native context requires multiple experimental strategies:

• Gene Knockout Studies: Create targeted gene deletions of HI_0976.1 in H. influenzae using techniques similar to those employed for rec-1 gene studies . Characterize the resulting phenotype under various growth conditions, including different osmotic stresses, pH values, and presence of potential toxic compounds.

• Complementation Experiments: Construct shuttle vectors carrying the HI_0976.1 gene (similar to the pRec1 vector described for rec-1 studies) to restore function in knockout strains and confirm phenotypic changes are due specifically to the absence of HI_0976.1.

• Transcriptional Analysis: Examine expression patterns of HI_0976.1 under various growth conditions using RT-PCR or RNA-Seq to identify conditions that induce or repress expression.

• Protein Localization Studies: Use fluorescent protein fusions or immunolocalization techniques to determine the subcellular localization of HI_0976.1, confirming its predicted membrane association.

• Interactome Analysis: Identify protein-protein interactions involving HI_0976.1 using techniques such as co-immunoprecipitation or bacterial two-hybrid systems to place it in a functional network context.

What are the optimal conditions for functional characterization of recombinant HI_0976.1 in vitro?

For optimal functional characterization of recombinant HI_0976.1 in vitro, researchers should consider the following methodological parameters:

Protein Reconstitution in Proteoliposomes:

Transport Assays:

For potential Na⁺/H⁺ antiport activity, researchers could establish an artificial pH gradient across proteoliposome membranes and measure Na⁺ uptake using radioactive ²²Na⁺ or fluorescent Na⁺ indicators. For potential drug transport activity, fluorescent substrates that change properties upon binding or transport should be utilized .

How can researchers overcome common challenges in expressing and purifying membrane proteins like HI_0976.1?

Membrane proteins like HI_0976.1 present unique challenges in expression and purification. The following methodological approaches can help overcome these challenges:

• Optimizing Expression Systems:

  • Consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Explore lower induction temperatures (16-25°C) and reduced inducer concentrations to slow production and facilitate proper membrane insertion

  • Test different fusion tags beyond His-tags, such as MBP or SUMO, which can enhance solubility

• Extraction and Solubilization:

  • Screen multiple detergents (DDM, LDAO, DMNG) at various concentrations to identify optimal solubilization conditions

  • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for extraction in a more native-like lipid environment

• Purification Strategy:

  • Include appropriate protease inhibitors throughout the purification process

  • Maintain detergent above critical micelle concentration in all buffers

  • Consider size exclusion chromatography as a final step to ensure homogeneity and remove aggregates

• Stability Enhancement:

  • Add stabilizing agents like glycerol (5-10%) throughout purification

  • Consider the addition of specific lipids that might be required for structural integrity

  • Maintain temperature control (typically 4°C) throughout purification processes

What structural biology techniques are most appropriate for elucidating the structure-function relationship of HI_0976.1?

Understanding the structure-function relationship of HI_0976.1 requires appropriate structural biology techniques:

For a 170-amino acid protein like HI_0976.1, a combination of these techniques would be ideal. Initially, homology modeling based on related MFS transporters could provide a structural framework. This could be followed by cryo-EM or X-ray crystallography to determine the actual structure, complemented by functional studies using site-directed mutagenesis to validate key residues involved in transport .

How should researchers interpret phenotypic data from HI_0976.1 knockout studies in Haemophilus influenzae?

When interpreting phenotypic data from HI_0976.1 knockout studies, researchers should consider several analytical approaches:

• Growth Curve Analysis: Compare growth parameters (lag phase, doubling time, maximum OD) between wild-type and knockout strains under various conditions. Statistically significant differences in high salt environments might indicate Na⁺ transport functionality, while differences in the presence of antimicrobial compounds might suggest drug efflux activity .

• Stress Response Analysis: Examine differential sensitivity to various stressors (pH, osmotic pressure, toxic compounds). For example, if HI_0976.1 functions similar to characterized MFS transporters like MdrP, the knockout strain might show increased sensitivity to high concentrations of Na⁺, Li⁺, or K⁺, as well as to certain antimicrobial compounds .

• Complementation Controls: Always include complementation experiments where the deleted gene is reintroduced, either on a plasmid or at a different chromosomal location, to confirm that observed phenotypes are specifically due to the absence of HI_0976.1 rather than polar effects or unintended mutations .

• Transcriptomic Response: Analyze global transcriptional changes in the knockout strain to identify compensatory mechanisms or regulatory networks connected to HI_0976.1 function.

What bioinformatic approaches can help predict the functional classification of HI_0976.1 within the MFS superfamily?

Several bioinformatic approaches can assist in predicting the functional classification of HI_0976.1:

• Sequence Motif Analysis: Identify conserved sequence motifs characteristic of specific MFS subfamilies. For example, search for the signature Motif A with consensus sequence GxLaDrxGrkxxl found in DHA1 family members, or other variant motifs found in DHA2-4 families .

• Phylogenetic Analysis: Construct phylogenetic trees including HI_0976.1 and characterized MFS transporters to determine its relationship to functionally characterized members. Similar to the analysis performed for MdrP, which formed a cluster with characterized multidrug efflux pumps LmrP and MdtH despite low sequence identity .

• Transmembrane Topology Prediction: Use algorithms like TMHMM, HMMTOP, or TOPCONS to predict the number and arrangement of transmembrane segments, which can help classify the protein into MFS subfamilies (12, 14, or 24 TMS subfamilies) .

• 3D Structure Prediction: Employ AlphaFold2 or RoseTTAFold to generate predicted structural models, which can be compared with solved structures of characterized MFS transporters to identify structural similarities despite low sequence conservation.

• Genomic Context Analysis: Examine the genes surrounding HI_0976.1 in the H. influenzae genome for functional clues, as transporters are often co-located with genes involved in the same metabolic or resistance pathways.

How might understanding HI_0976.1 function contribute to antimicrobial resistance research in Haemophilus influenzae?

Understanding the function of HI_0976.1 could significantly impact antimicrobial resistance research if the protein functions as a multidrug efflux pump, similar to characterized MFS transporters in the DHA families . Research directions could include:

• Resistance Profile Determination: If HI_0976.1 is confirmed as a drug efflux pump, characterizing its substrate specificity would reveal which antibiotics might be less effective against H. influenzae due to active efflux.

• Inhibitor Development: Identifying specific inhibitors of HI_0976.1 could lead to adjuvant therapies that restore antibiotic sensitivity by blocking efflux pathways.

• Expression Regulation: Understanding how HI_0976.1 expression is regulated could reveal how H. influenzae adapts to antibiotic pressure and potentially identify targets to prevent upregulation of efflux systems.

• Structural Basis of Transport: Detailed structural studies could reveal the molecular mechanism of substrate recognition and transport, potentially applicable to other bacterial transporters involved in antimicrobial resistance.

• Clinical Isolate Variation: Investigating sequence variations in HI_0976.1 across clinical isolates could help determine if specific variants correlate with increased resistance profiles in clinical settings.

What experimental approaches would be most effective for studying potential dual functionality of HI_0976.1?

Based on findings with other MFS transporters like MdrP, which exhibits dual functions as both a Na⁺(Li⁺,K⁺)/H⁺ antiporter and a multidrug efflux pump , researchers should consider the following experimental approach to investigate potential dual functionality of HI_0976.1:

• Parallel Functional Assays: Simultaneously test for both cation/H⁺ antiport activity and drug efflux capability using:

  • Na⁺/H⁺ antiport activity assays in inside-out membrane vesicles

  • Minimum inhibitory concentration (MIC) tests with various antibiotics

  • Fluorescent substrate accumulation/efflux assays

• Mutational Dissection: Create point mutations in conserved residues to determine if the two potential functions can be separated genetically, which would indicate distinct structural elements for each function.

• Competition Assays: Test whether cation transport and drug efflux functions compete with each other by measuring one function in the presence of substrates for the other function.

• Heterologous Expression in Specific Knockout Strains: Express HI_0976.1 in E. coli strains specifically deficient in either Na⁺/H⁺ antiporters (like KNabc) or multidrug efflux pumps to assess each function independently .

• Structural Studies in Different Substrate-Bound States: If structural determination is successful, compare the protein structure when bound to cations versus antimicrobial compounds to identify conformational changes specific to each function.