Recombinant Haemophilus influenzae UPF0053 protein HI_0056 (HI_0056)

What is the structural characterization of UPF0053 protein HI_0056?

UPF0053 protein HI_0056 is a 237-amino acid protein from Haemophilus influenzae with the following sequence: MFEWIADPEAWISLVTLAALEIVLGIDNIIFINILVGRLPERQRQSGRILGLALAMLTRILLLMSLAWIMKLTAPLFTVFNQEISGRDLILLIGGLFLIIKSSGEIKEAINHQEHHESESKNKVSYLGVLIQIAVLDIVFSLDSVITAVGMASHLPVMILAIMIAVGVMMFAAKPIGDFVDTHPTLKILALAFLVLVGISLIAESLDIHIPKGYIYFAMGFSVVVEMINIRMRRLMK . The protein belongs to the UPF0053 family, though detailed tertiary structure analysis has not been fully characterized in the current literature. Based on sequence analysis, it appears to contain multiple transmembrane domains, suggesting it may function as a membrane protein. Researchers typically work with the recombinant form expressed in E. coli with an N-terminal His-tag for purification purposes.

How does HI_0056 protein compare to homologous proteins in other bacterial species?

The UPF0053 family of proteins is conserved across multiple bacterial species, making comparative analysis valuable for understanding evolutionary relationships. While H. influenzae is a gram-negative bacterium that typically lives symbiotically in the human upper respiratory tract , the HI_0056 protein shares sequence similarity with proteins found in other pathogenic bacteria. Comparative genomic analyses suggest conservation of key functional domains across species, though specific variations may relate to host adaptation and virulence. When investigating homologous proteins, researchers should perform multiple sequence alignments and phylogenetic analyses to determine conserved regions that may indicate functional importance.

What expression systems are optimal for recombinant HI_0056 production?

The standard expression system for recombinant HI_0056 protein utilizes E. coli as a host organism . The protein is typically expressed with an N-terminal His-tag to facilitate purification through affinity chromatography. Based on experimental design approaches for recombinant protein expression, optimal conditions include:

• Growth until an absorbance of 0.8 (measured at 600 nm)

• Induction with 0.1 mM IPTG

• Expression for 4 hours at 25°C

• Medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

• Addition of appropriate antibiotic (e.g., 30 μg/mL kanamycin)

These conditions have been shown to enhance soluble protein expression while minimizing inclusion body formation, which is critical for obtaining functionally active protein. The timing of induction during the mid-exponential growth phase is particularly important for maximizing protein yield, as induction during stationary phase often results in lower expression levels due to reduced metabolic activity .

What factorial design approach is recommended for optimizing HI_0056 expression?

When optimizing recombinant HI_0056 expression, a multivariate statistical design approach is strongly recommended over traditional univariate methods. A fractional factorial design (such as a 2^8-4 design) allows researchers to evaluate multiple variables simultaneously while identifying significant interactions between factors . For HI_0056 expression, the following parameters should be included in the experimental design:

How should researchers properly reconstitute and store the lyophilized HI_0056 protein?

Proper reconstitution and storage are critical for maintaining protein stability and activity. Follow these methodological steps:

• Centrifuge the vial briefly prior to opening to bring contents to the bottom

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended optimal: 50%)

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Store aliquots at -20°C/-80°C for long-term storage

• For working stocks, store aliquots at 4°C for up to one week

Important note: Repeated freeze-thaw cycles should be strictly avoided as they can significantly reduce protein activity. The reconstitution buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is specifically formulated to maintain protein stability . For experiments requiring different buffer conditions, researchers should use dialysis to gradually exchange buffers while monitoring protein stability.

What purification strategies yield the highest purity of HI_0056 protein?

For His-tagged recombinant HI_0056, a multi-step purification strategy is recommended:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Equilibrate column with binding buffer (50 mM Tris-HCl, 300 mM NaCl, 10 mM imidazole, pH 8.0)

  • Apply clarified cell lysate

  • Wash with binding buffer containing 20-30 mM imidazole to remove weakly bound proteins

  • Elute with elution buffer containing 250-300 mM imidazole

• Intermediate purification: Ion exchange chromatography

  • Dialyze IMAC eluate against low-salt buffer

  • Apply to appropriate ion exchange column based on protein's theoretical pI

  • Elute with salt gradient

• Polishing step: Size exclusion chromatography

  • Apply concentrated protein to appropriate size exclusion column

  • Collect fractions and analyze by SDS-PAGE

This strategy typically yields protein with greater than 90% purity as determined by SDS-PAGE . The purification process should be monitored using activity assays to ensure that functional protein is being recovered. For specific research applications requiring ultra-high purity, additional chromatographic steps may be necessary.

How can researchers evaluate the membrane integration properties of HI_0056?

Based on sequence analysis, HI_0056 appears to contain multiple transmembrane domains, suggesting integration into bacterial membranes. To study membrane integration properties:

• Membrane fraction isolation:

  • Separate cell fractions (cytoplasmic, periplasmic, and membrane) through differential centrifugation

  • Confirm protein localization through Western blotting with anti-His antibodies

• Lipid interaction studies:

  • Reconstitute purified protein in liposomes with defined lipid composition

  • Evaluate protein-lipid interactions using techniques such as:

    • Fluorescence spectroscopy

    • Surface plasmon resonance

    • Differential scanning calorimetry

• Structural characterization in membrane environment:

  • Circular dichroism spectroscopy to assess secondary structure

  • NMR spectroscopy for detailed structural information

  • Cryo-electron microscopy for visualization of protein-membrane complexes

These methodological approaches allow researchers to characterize how the native protein likely interacts with the bacterial membrane, providing insights into its biological function.

What are the recommended approaches for investigating potential binding partners of HI_0056?

Understanding protein-protein interactions is crucial for elucidating HI_0056 function. Several complementary approaches are recommended:

• Pull-down assays:

  • Use His-tagged HI_0056 as bait with H. influenzae lysate

  • Identify binding partners through mass spectrometry analysis

• Yeast two-hybrid screening:

  • Construct appropriate bait and prey vectors

  • Screen against H. influenzae genomic library

• Surface plasmon resonance:

  • Immobilize purified HI_0056 on sensor chip

  • Flow potential binding partners over the surface

  • Measure binding kinetics and affinity constants

• Cross-linking studies:

  • Perform in vivo cross-linking in H. influenzae

  • Identify cross-linked complexes through mass spectrometry

• Co-immunoprecipitation:

  • Generate specific antibodies against HI_0056

  • Immunoprecipitate protein complexes from H. influenzae lysate

These methodologies should be used in combination to build a comprehensive interaction network and validate true binding partners through multiple independent techniques.

How does the UPF0053 protein family contribute to H. influenzae pathogenesis?

H. influenzae is known to cause significant human disease, with type b strains (Hib) being particularly virulent . While the direct role of HI_0056 in pathogenesis is not fully characterized, research methodology to investigate this includes:

• Gene knockout studies:

  • Generate HI_0056 deletion mutants

  • Assess changes in bacterial virulence in appropriate infection models

  • Complement mutants to confirm phenotype specificity

• Transcriptomic analysis:

  • Compare gene expression profiles between wild-type and HI_0056 mutants

  • Identify pathways affected by HI_0056 deletion

• Host-pathogen interaction studies:

  • Assess adherence to and invasion of human epithelial cells

  • Measure resistance to host defense mechanisms

  • Evaluate inflammatory responses elicited by wild-type versus mutant strains

• In vivo infection models:

  • Compare colonization efficiency and persistence

  • Assess disease progression and severity

Through these approaches, researchers can systematically evaluate whether HI_0056 contributes to key virulence phenotypes such as colonization, immune evasion, or tissue invasion.

What strategies can resolve low solubility issues when expressing recombinant HI_0056?

Low solubility is a common challenge when expressing membrane or membrane-associated proteins like HI_0056. To address this issue:

• Optimize expression conditions:

  • Lower induction temperature (16-20°C)

  • Reduce IPTG concentration (0.01-0.05 mM)

  • Induce at lower cell density (OD600 of 0.4-0.6)

  • Add osmolytes (e.g., sorbitol, glycine betaine) to culture medium

• Use solubility-enhancing fusion partners:

  • MBP (maltose-binding protein)

  • SUMO (small ubiquitin-like modifier)

  • Thioredoxin

  • NusA

• Co-express with molecular chaperones:

  • GroEL/GroES

  • DnaK/DnaJ/GrpE

  • Trigger factor

• Use specialized E. coli strains:

  • C41(DE3) or C43(DE3) for membrane proteins

  • Origami or SHuffle for disulfide bond formation

  • Arctic Express for low-temperature expression

• Apply statistical experimental design:

  • Implement fractional factorial designs to identify optimal conditions

  • Focus on variables with significant effects on soluble expression

By systematically applying these approaches and using the statistical experimental design methodology outlined in section 2.1, researchers can significantly improve soluble expression levels.

How can researchers troubleshoot protein degradation during purification of HI_0056?

Protein degradation during purification can significantly reduce yield and affect functional studies. Address this problem through:

• Protease inhibition strategies:

  • Add protease inhibitor cocktail to all buffers

  • Include specific inhibitors based on susceptible cleavage sites

  • Maintain samples at 4°C throughout purification

  • Add EDTA (1-5 mM) to inhibit metalloproteases

• Buffer optimization:

  • Adjust pH to minimize proteolytic activity

  • Include stabilizing agents (glycerol, trehalose)

  • Test different buffer systems for optimal stability

• Rapid purification protocols:

  • Minimize time between steps

  • Consider automated chromatography systems

  • Use streamlined protocols with fewer steps

• Expression modifications:

  • Co-express with protease inhibitors

  • Remove recognition sequences for endogenous proteases

  • Engineer stabilizing mutations

• Storage considerations:

  • Aliquot purified protein to avoid freeze-thaw cycles

  • Add glycerol (50% final concentration) for long-term storage

  • Monitor stability under different storage conditions

Systematically implementing these approaches while monitoring protein integrity through SDS-PAGE and activity assays will help identify the specific causes of degradation and develop effective countermeasures.

What analytical methods are most effective for assessing HI_0056 functionality?

Without specific information on HI_0056 function, researchers should employ multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism spectroscopy for secondary structure

  • Fluorescence spectroscopy for tertiary structure

  • Size exclusion chromatography for oligomeric state

• Binding assays (if membrane transporter function is suspected):

  • Substrate binding assays using fluorescent or radiolabeled ligands

  • Isothermal titration calorimetry for thermodynamic parameters

  • Surface plasmon resonance for binding kinetics

• Functional assays (based on predicted function):

  • Membrane potential measurements

  • Ion flux assays

  • Transport assays in reconstituted systems

• Comparative analysis:

  • Complementation assays in knockout strains

  • Activity comparison with homologous proteins of known function

Each analytical method should include appropriate positive and negative controls, and results should be evaluated using rigorous statistical analysis to ensure reproducibility and significance.

How might structural biology approaches advance understanding of HI_0056 function?

Advanced structural biology techniques offer promising avenues for elucidating HI_0056 function:

• Cryo-electron microscopy:

  • Determine high-resolution structure in native-like lipid environments

  • Visualize conformational changes upon substrate binding

  • Identify functional domains and potential binding sites

• X-ray crystallography:

  • Obtain atomic-resolution structures

  • Co-crystallize with potential binding partners or substrates

  • Analyze structure-function relationships

• Nuclear magnetic resonance (NMR) spectroscopy:

  • Characterize dynamic properties

  • Identify flexible regions and conformational changes

  • Map interaction interfaces with binding partners

• Molecular dynamics simulations:

  • Model protein behavior in membrane environments

  • Simulate potential substrate transport mechanisms

  • Predict effects of mutations on protein structure and function

• Integrative structural biology:

  • Combine multiple techniques (cryo-EM, NMR, SAXS, etc.)

  • Generate comprehensive structural models across different functional states

These approaches would provide unprecedented insights into the molecular mechanism of HI_0056 function and potentially reveal novel therapeutic targets for treating H. influenzae infections.

What gene polymorphisms of HI_0056 exist across H. influenzae strains and what are their functional implications?

Investigating HI_0056 polymorphisms requires a systematic approach:

• Comparative genomic analysis:

  • Sequence HI_0056 gene from diverse clinical isolates

  • Compare sequences from different serotypes and non-typeable strains

  • Identify conserved regions versus variable domains

• Structure-function correlation:

  • Map polymorphisms onto structural models

  • Assess conservation in predicted functional domains

  • Evaluate potential impact on protein function

• Experimental validation:

  • Express variant proteins and compare biochemical properties

  • Perform complementation studies in different strain backgrounds

  • Assess functional differences through appropriate assays

• Clinical correlation:

  • Associate specific polymorphisms with virulence or antibiotic resistance

  • Evaluate potential as diagnostic or therapeutic targets

  • Investigate evolutionary pressure on different protein domains

This research direction could provide valuable insights into H. influenzae pathogenesis and adaptation, potentially uncovering strain-specific virulence mechanisms that could be targeted for therapeutic intervention.