Recombinant Haemophilus influenzae UPF0053 protein HI_0452 (HI_0452)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development accordingly.
Synonyms
paeA; HI_0452; Polyamine export protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0452
Target Protein Sequence
MIMELFHTILAIVALILSSAVVSSAEISLASPRKLKLQSLANKGDVRPLQVLKLQEHPGR FITVVQILLNMVAILGGGIGESALSPYIADILNRSFEGSWIAPTASTIAFILVTCLFILF ADLIPKRIAITYPEMVALSVVGIMNFSMYVFKPLVWFFDTIANVFFRLFRISTVREDGMT SEDIFAVVEAGAEAGVLKTQEHYLIENIFDMQARTVTSTMTTRENIVYLDRTFSRQEVMD TLSRDSHSKIVICDNGLDKILGYIESHTLLTMYLQNENVVLTDPKLLRKALFVPDTLSLY EVLELFKSTGEDFAIIVNEYALVVGIVTLNDVMSIVMGELVSNEEEYIVSRDENSWLIDG ATPLEEVTRVLDIAYFPDEENYETISGFMMYMLRKIPKKTDSVVYGKYKFEVIDTENFKI DQILVSLVKEQE
Uniprot No.

Target Background

Function
This protein is involved in cadaverine and putrescine tolerance during the stationary phase. It potentially facilitates the efflux of both cadaverine and putrescine from the cytoplasm, mitigating potentially toxic levels under specific stress conditions.
Database Links

KEGG: hin:HI0452

STRING: 71421.HI0452

Protein Families
UPF0053 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus influenzae UPF0053 protein HI_0452?

Haemophilus influenzae UPF0053 protein HI_0452 (also known as paeA) is a polyamine export protein expressed by Haemophilus influenzae, a common inhabitant of the upper respiratory tract that can cause serious mucosal surface infections . The protein consists of 432 amino acids with a specific sequence beginning with MIMELFHTILA and ending with LVSLVKEQE . As a membrane protein, it plays a role in polyamine transport and is classified within the UPF0053 protein family, which remains under investigation for its precise functions in bacterial physiology .

How is recombinant HI_0452 protein typically expressed?

Recombinant HI_0452 protein is typically expressed in E. coli expression systems using recombinant DNA technology. The full-length protein (amino acids 1-432) is commonly fused to an N-terminal His-tag to facilitate purification . Expression is often placed under the control of inducible promoters, such as T7 promoters that can be activated using IPTG induction, similar to the approach used for other H. influenzae proteins like P4 . This controlled expression system allows for high-level production of the target protein while minimizing potential toxicity to the host cells during the growth phase.

What purification methods are effective for recombinant HI_0452 protein?

Effective purification of His-tagged recombinant HI_0452 protein typically involves a multi-step chromatographic approach:

  • Affinity Chromatography: Initially using Ni-NTA or similar metal affinity resins to capture the His-tagged protein

  • Size Exclusion Chromatography: Further purifying based on molecular size

This approach is similar to the two-step chromatography method demonstrated for H. influenzae recombinant P4 protein, which achieved apparent homogeneity . After purification, protein purity can be verified by SDS-PAGE, with commercial preparations typically achieving >90% purity . For membrane proteins like HI_0452, careful consideration of detergent conditions during extraction and purification is essential to maintain protein structure and function.

How should researchers optimize storage conditions for recombinant HI_0452 protein?

Recombinant HI_0452 protein storage should be optimized based on both short-term and long-term stability requirements:

Storage DurationRecommended ConditionsAdditional Notes
Short-term (≤1 week)4°CMaintain in working aliquots to avoid repeated freeze-thaw cycles
Long-term-20°C or preferably -80°CRequires proper aliquoting for multiple use
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains structural integrity during storage
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol (final concentration) for long-term storage

For optimal results, researchers should briefly centrifuge vials prior to opening to bring contents to the bottom and avoid repeated freeze-thaw cycles which significantly affect protein stability . The addition of 50% glycerol as a cryoprotectant in final preparations has been shown to effectively preserve protein function during frozen storage .

What experimental approaches can characterize the structure-function relationship of HI_0452?

To characterize the structure-function relationship of HI_0452, researchers should employ a multidisciplinary approach:

  • Primary Structure Analysis: Compare the amino acid sequence with known polyamine export proteins using bioinformatics tools to identify conserved domains and functional motifs.

  • Secondary Structure Prediction: Utilize circular dichroism (CD) spectroscopy to determine alpha-helix and beta-sheet content, complemented by computational prediction tools.

  • Tertiary Structure Determination: Apply X-ray crystallography or cryo-electron microscopy (cryo-EM) techniques, using the purified recombinant His-tagged protein after optimizing crystallization conditions.

  • Functional Assays: Design transport assays to measure polyamine export activity using radioactively labeled substrates or fluorescence-based methods to correlate structural elements with transport function.

  • Site-Directed Mutagenesis: Create targeted mutations in conserved regions to evaluate their impact on protein function, similar to approaches used with other H. influenzae proteins .

This comprehensive approach will yield insights into which structural elements are essential for the polyamine export function of HI_0452.

How can researchers verify the integrity and activity of recombinant HI_0452 protein?

Researchers should implement multiple complementary methods to verify both structural integrity and functional activity of recombinant HI_0452:

  • SDS-PAGE Analysis: Confirm molecular weight and purity (>90% purity standard for research applications) .

  • Western Blot Analysis: Verify protein identity using anti-His antibodies (for His-tagged constructs) or specific antibodies against HI_0452.

  • Mass Spectrometry: Validate the complete amino acid sequence and identify any post-translational modifications.

  • Thermal Shift Assays: Assess protein stability under different buffer conditions.

  • Transport Assays: Measure polyamine export activity through reconstitution in liposomes or bacterial membrane vesicles.

  • Circular Dichroism: Confirm proper protein folding by analyzing secondary structure elements.

Functional integrity is particularly important as improper folding can yield pure but inactive protein preparations. Activity assays should be performed under physiologically relevant pH and temperature conditions (similar to approaches used with the P4 protein from H. influenzae) .

What strategies can address membrane integration challenges when working with recombinant HI_0452?

Addressing membrane integration challenges with recombinant HI_0452 requires sophisticated approaches:

  • Detergent Screening: Systematically test multiple detergent classes (maltoside, glucoside, and neopentyl glycol derivatives) at various concentrations to identify optimal conditions for extraction that maintain native conformation.

  • Nanodiscs and Liposome Reconstitution: Incorporate purified HI_0452 into nanodiscs or liposomes composed of bacterial membrane-mimicking lipid compositions to create a native-like environment for functional studies.

  • Co-expression Systems: Utilize specialized E. coli strains engineered to co-express membrane protein chaperones that facilitate proper folding and insertion of membrane proteins.

  • Signal Sequence Modification: Similar to approaches with H. influenzae P4 protein, modify N-terminal signal sequences to enhance protein secretion and proper membrane insertion . This can involve replacing the native signal sequence with one optimized for the expression system.

  • In vitro Translation Systems: Employ cell-free expression systems with added microsomes or nanodiscs for direct integration during translation.

These approaches can be evaluated using activity assays to determine which method best preserves the functional state of HI_0452.

How can researchers investigate potential interacting partners of HI_0452 in Haemophilus influenzae?

To investigate potential interacting partners of HI_0452 in Haemophilus influenzae, researchers should implement the following comprehensive strategy:

  • Co-immunoprecipitation (Co-IP): Using antibodies against native HI_0452 or the His-tag of recombinant protein to pull down protein complexes from bacterial lysates, followed by mass spectrometry identification.

  • Bacterial Two-Hybrid System: Construct fusion proteins to screen for potential interactors in a specialized bacterial two-hybrid assay optimized for membrane proteins.

  • Cross-linking Studies: Apply membrane-permeable cross-linking agents to stabilize transient interactions in vivo before purification and analysis.

  • Proximity Labeling: Employ BioID or APEX2 fusion constructs to biotinylate proteins in close proximity to HI_0452 in the native environment.

  • Surface Plasmon Resonance (SPR): Use purified recombinant HI_0452 immobilized on sensor chips to detect binding interactions with candidate partner proteins.

  • Comparative Genomics: Analyze gene neighborhood and co-occurrence patterns across bacterial species to identify functionally related proteins that may physically interact with HI_0452.

Results from these complementary approaches should be validated through functional assays that demonstrate the biological relevance of identified interactions.

What methodological approaches can elucidate the role of HI_0452 in pathogenicity and drug resistance?

To elucidate HI_0452's role in pathogenicity and drug resistance, researchers should implement these advanced methodological approaches:

  • Gene Knockout/Knockdown Studies: Generate HI_0452 deletion mutants in H. influenzae and assess changes in:

    • Virulence in appropriate infection models

    • Antibiotic susceptibility profiles

    • Polyamine homeostasis

    • Stress response capabilities

  • Controlled Expression Systems: Create strains with inducible expression of HI_0452 to examine dose-dependent effects on pathogenicity markers.

  • Structure-Based Drug Design: Use the three-dimensional structure of recombinant HI_0452 to:

    • Identify potential inhibitor binding sites

    • Screen chemical libraries for compounds that may disrupt function

    • Develop potential antivirulence agents targeting polyamine transport

  • Transcriptomic Analysis: Compare gene expression profiles between wild-type and HI_0452-mutant strains under various conditions to identify regulated pathways.

  • In vivo Competition Assays: Perform mixed infections with wild-type and mutant strains to assess competitive fitness advantages conferred by HI_0452.

  • Polymorphism Analysis: Examine HI_0452 sequence variations across clinical isolates to correlate specific variants with virulence or resistance phenotypes.

These approaches would provide comprehensive insights into how HI_0452 contributes to H. influenzae's pathogenic potential and whether it represents a viable target for novel antimicrobial strategies.

What are common pitfalls in recombinant HI_0452 expression and how can they be addressed?

Common pitfalls in recombinant HI_0452 expression and their solutions include:

PitfallCauseSolution Approach
Low expression yieldToxicity to host cellsUse tightly regulated inducible promoter systems; optimize induction timing and temperature
Inclusion body formationProtein misfoldingExpress at lower temperatures (16-25°C); co-express molecular chaperones; use specialized E. coli strains
Protein degradationProtease activityAdd protease inhibitors; use protease-deficient host strains
Poor membrane insertionInadequate translocation machineryOptimize signal sequences; use membrane protein-specific expression hosts
Loss of N-terminal His-tagN-terminal processingMove the His-tag to the C-terminus or use an alternative tagging strategy
Protein aggregationDetergent incompatibilityScreen multiple detergent types and concentrations for optimal solubilization

Researchers should consider these challenges when designing expression strategies for HI_0452, drawing on experience with other membrane proteins from H. influenzae that have shown similar expression challenges .

How can researchers design assays to measure polyamine transport activity of recombinant HI_0452?

To effectively measure the polyamine transport activity of recombinant HI_0452, researchers should implement these specialized assay designs:

  • Radioactive Flux Assays: Incorporate purified HI_0452 into proteoliposomes and measure the uptake or efflux of radiolabeled polyamines (e.g., [14C]-spermidine, [3H]-putrescine) across the membrane.

  • Fluorescence-Based Transport Assays: Use fluorescently labeled polyamine analogs or pH-sensitive fluorophores to monitor transport in real-time.

  • Whole-Cell Transport Assays: Compare polyamine uptake/export between wild-type H. influenzae and HI_0452 knockout strains to determine transport kinetics under physiological conditions.

  • Electrophysiological Approaches: Apply patch-clamp techniques to proteoliposomes or bacterial spheroplasts expressing HI_0452 to measure transport-associated currents.

  • Competition Assays: Determine substrate specificity by measuring how various polyamines and analogs compete for transport.

The assay design should include appropriate controls such as:

  • Proteoliposomes without HI_0452 (negative control)

  • Proteoliposomes with known polyamine transporters (positive control)

  • Varying substrate concentrations to determine Km and Vmax values

  • pH and ion dependence to establish optimal transport conditions

Results from these assays would provide a comprehensive functional characterization of HI_0452's transport properties and substrate specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.