Protein Structure and Expression: The HI_0507 protein is expressed in E. coli and consists of 183 amino acids. It is fused with an N-terminal His tag, which facilitates purification and detection using standard biochemical techniques .
Purity and Storage: The protein is available in a lyophilized form with a purity of greater than 90% as determined by SDS-PAGE. It is recommended to store it at -20°C or -80°C to maintain stability .
Amino Acid Sequence: The amino acid sequence of HI_0507 is MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH .
Biological Research: Recombinant proteins like HI_0507 are used in various biological studies, including protein-protein interaction assays, enzyme activity tests, and structural biology studies. These proteins help researchers understand the molecular mechanisms underlying bacterial infections and identify potential drug targets.
ELISA and Other Assays: While specific ELISA kits for HI_0507 are not widely documented, recombinant proteins can be used to develop such assays for detecting antibodies or studying protein interactions .
Pathogenicity Studies: Haemophilus influenzae proteins, including autotransporters and other virulence factors, play significant roles in bacterial pathogenesis. Understanding these proteins can provide insights into how H. influenzae causes disease and how it might be targeted therapeutically .
| Characteristic | Description |
|---|---|
| Species | Haemophilus influenzae |
| Source | E. coli |
| Tag | N-terminal His tag |
| Protein Length | Full Length (1-183aa) |
| Form | Lyophilized powder |
| Purity | >90% by SDS-PAGE |
| Storage | -20°C or -80°C |
| Sequence |
|---|
| MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH |
KEGG: hin:HI0507
STRING: 71421.HI0507
The recommended expression system for HI_0507 is E. coli with an N-terminal His-tag. This approach has been validated to produce full-length protein (amino acids 1-183) with purity exceeding 90% as confirmed by SDS-PAGE analysis. The expression construct should include:
A strong inducible promoter (T7 or tac)
N-terminal His-tag for purification
Appropriate signal sequence if membrane localization is desired
For optimal expression, consider testing multiple E. coli strains (BL21(DE3), Rosetta, or Origami) as membrane proteins often present expression challenges. Induction parameters should be optimized at lower temperatures (16-25°C) to enhance proper folding .
Purification Protocol:
Harvest E. coli cells and lyse using appropriate buffer systems containing mild detergents
Purify using IMAC (Immobilized Metal Affinity Chromatography) leveraging the His-tag
Further purify via size exclusion chromatography if higher purity is required
Confirm purity via SDS-PAGE (>90% purity is achievable)
Storage Requirements:
Store lyophilized protein at -20°C/-80°C upon receipt
For reconstituted protein, aliquot to avoid freeze-thaw cycles
Short-term storage (up to one week): 4°C in working buffer
Long-term storage: Add 5-50% glycerol (optimal: 50%) and store at -20°C/-80°C
Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for storage
For optimal reconstitution of lyophilized HI_0507:
Briefly centrifuge the vial before opening to collect contents at the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
For long-term storage preparations, add glycerol to a final concentration of 5-50% (recommended: 50%)
Aliquot into single-use volumes to prevent repeated freeze-thaw cycles
Validate protein integrity via SDS-PAGE before experimental use
When designing experiments, consider that HI_0507 is a membrane protein, which may require specific buffer conditions to maintain proper folding and functionality. For functional assays, perform initial validation experiments to determine optimal protein concentration ranges .
| Method | Application | Technical Considerations |
|---|---|---|
| SDS-PAGE | Purity assessment, molecular weight confirmation | Use 12-15% gels for optimal resolution |
| Western Blot | Detection using anti-His antibodies | Include positive controls and size markers |
| Circular Dichroism | Secondary structure analysis | Buffer components must be CD-compatible |
| Mass Spectrometry | Exact mass determination, PTM identification | Consider detergent removal before analysis |
| Dynamic Light Scattering | Aggregation assessment | Filter samples before measurement |
| Thermal Shift Assay | Stability assessment | Test multiple buffer conditions |
When performing SDS-PAGE analysis, which is the most commonly reported method for HI_0507, ensure complete denaturation of the sample and use appropriate molecular weight markers. The expected band should appear at approximately 20-22 kDa (accounting for the His-tag) .
While direct evidence for HI_0507's role in virulence is still emerging, comparative analysis with other H. influenzae proteins provides context:
Protein H (PH): A surface-exposed lipoprotein found in encapsulated H. influenzae type b (Hib) and type f (Hif) that binds factor H, a major regulator of the alternative pathway of complement activation. This interaction is crucial for bacterial resistance against complement activation and pathogenesis .
HMW1 Adhesin: A key factor in intracellular invasion by H. influenzae, with transformation of the hmw1 operon resulting in ~1,000-fold increased invasion into airway epithelial cells. This protein facilitates bacterial self-aggregation and adherence to airway cells .
Given that HI_0507 is also a membrane-associated protein, researchers should investigate potential interactions with these better-characterized virulence factors, particularly in the context of host-pathogen interactions .
For in-depth functional analysis of HI_0507, consider these genetic approaches:
Gene Deletion/Knockout: Create lph (gene encoding for HI_0507) deletion mutants using homologous recombination or CRISPR-Cas9 systems. Compare phenotypes with wild-type strains to identify functional roles, similar to approaches used for studying Protein H .
Transformed Recombinant Enrichment Profiling (TREP): This technique could be particularly valuable, as demonstrated with HMW1. TREP uses natural transformation to generate complex pools of recombinants, followed by phenotypic selection and deep sequencing to identify genetic variations responsible for specific phenotypes .
Allelic Replacement: Replace the native hi_0507 gene with tagged or mutated versions to study protein domains and their functions.
Complementation Studies: Reintroduce the wild-type gene in knockout strains to confirm phenotype restoration.
These approaches would help establish the specific role of HI_0507 in H. influenzae biology and potential contributions to pathogenesis .
To explore potential host-pathogen interactions:
Protein-Protein Interaction Studies:
Pull-down assays using His-tagged HI_0507
Co-immunoprecipitation with potential host targets
Surface plasmon resonance to measure binding kinetics
Bacterial two-hybrid systems
Cell Culture Models:
Infection assays using respiratory epithelial cell lines
Quantification of adhesion, invasion, and intracellular survival
Immunofluorescence to track protein localization during infection
Flow cytometry to measure host cell responses
Comparative Analysis:
These methodologies would provide insights into whether HI_0507 participates in host-pathogen interactions that contribute to H. influenzae colonization or pathogenesis.
For computational analysis of HI_0507:
Sequence-Based Analysis:
Multiple sequence alignment with homologs across bacterial species
Identification of conserved domains and motifs
Prediction of post-translational modifications
Signal peptide and transmembrane domain prediction
Structural Prediction:
Ab initio modeling using tools like AlphaFold2 or RoseTTAFold
Molecular dynamics simulations to study protein flexibility
Protein-protein docking with potential interaction partners
Identification of potential ligand binding pockets
Evolutionary Analysis:
Phylogenetic trees to understand evolutionary relationships
Analysis of selection pressure on specific residues
Identification of co-evolving residues suggesting functional importance
These computational approaches can guide experimental design by highlighting regions of potential functional importance and generating testable hypotheses about HI_0507's role in H. influenzae biology .
While detailed structural information about HI_0507 is still emerging, comparative analysis with better-characterized H. influenzae membrane proteins provides valuable context:
Researchers should consider investigating whether HI_0507 shares functional similarities with these better-characterized proteins, particularly in the context of host-pathogen interactions and immune evasion strategies .
Working with membrane proteins like HI_0507 presents specific challenges:
Solubility Issues: As a membrane protein, HI_0507 may require detergents or specialized buffer systems to maintain solubility and proper folding.
Structural Determination: Membrane proteins typically present greater challenges for structural studies compared to soluble proteins.
Functional Assays: Establishing appropriate functional assays may be difficult without clear understanding of the protein's role.
Expression Optimization: Expression levels may be lower than for soluble proteins, requiring optimization of expression conditions.
By comparison, proteins like Protein H have established functional assays (Factor H binding) and HMW1 has clear phenotypic outcomes (adhesion, invasion) that facilitate their study. Researchers should develop systematic approaches to characterize HI_0507's function through comparative studies with these better-understood proteins .
Future research on HI_0507 should consider these approaches:
Systems Biology Integration:
Proteomics to identify interaction partners under different conditions
Transcriptomics to determine expression patterns during infection
Metabolomics to identify pathway alterations in knockout strains
In vivo Models:
Animal models to compare virulence of wild-type vs. hi_0507 mutants
Competitive index assays to measure fitness contributions
Tissue-specific expression analysis during infection
Structural Biology:
Cryo-EM or X-ray crystallography to determine 3D structure
Structure-guided mutagenesis to identify functional domains
Protein dynamics studies using hydrogen-deuterium exchange mass spectrometry
These approaches would contribute to a comprehensive understanding of HI_0507's role in H. influenzae biology and potential contributions to pathogenesis, building on established methodologies used for other virulence factors .
Understanding HI_0507 variation across clinical isolates is crucial:
Sequence Variation Analysis:
Compare hi_0507 sequences across clinical isolates from different:
Disease manifestations (invasive vs. non-invasive)
Body sites (respiratory tract, blood, CSF)
Patient populations (age groups, immunocompetent vs. immunocompromised)
Expression Level Comparison:
Quantify HI_0507 expression in different clinical contexts
Identify regulatory mechanisms controlling expression
Correlate expression levels with virulence or antibiotic resistance
Function Comparison:
Assess whether sequence variants have altered functions
Determine if specific variants correlate with disease severity