Recombinant Haemophilus influenzae UPF0114 protein HI_0507 (HI_0507)

Shipped with Ice Packs
In Stock

Description

Characteristics of Recombinant Haemophilus influenzae UPF0114 Protein HI_0507

  • Protein Structure and Expression: The HI_0507 protein is expressed in E. coli and consists of 183 amino acids. It is fused with an N-terminal His tag, which facilitates purification and detection using standard biochemical techniques .

  • Purity and Storage: The protein is available in a lyophilized form with a purity of greater than 90% as determined by SDS-PAGE. It is recommended to store it at -20°C or -80°C to maintain stability .

  • Amino Acid Sequence: The amino acid sequence of HI_0507 is MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH .

Applications and Research Findings

  • Biological Research: Recombinant proteins like HI_0507 are used in various biological studies, including protein-protein interaction assays, enzyme activity tests, and structural biology studies. These proteins help researchers understand the molecular mechanisms underlying bacterial infections and identify potential drug targets.

  • ELISA and Other Assays: While specific ELISA kits for HI_0507 are not widely documented, recombinant proteins can be used to develop such assays for detecting antibodies or studying protein interactions .

  • Pathogenicity Studies: Haemophilus influenzae proteins, including autotransporters and other virulence factors, play significant roles in bacterial pathogenesis. Understanding these proteins can provide insights into how H. influenzae causes disease and how it might be targeted therapeutically .

Table 1: Characteristics of Recombinant Haemophilus influenzae UPF0114 Protein HI_0507

CharacteristicDescription
SpeciesHaemophilus influenzae
SourceE. coli
TagN-terminal His tag
Protein LengthFull Length (1-183aa)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage-20°C or -80°C

Table 2: Amino Acid Sequence of HI_0507

Sequence
MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HI_0507; UPF0114 protein HI_0507
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0507
Target Protein Sequence
MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIYSYKFIKGLWELVINV NDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRNHPDQPEWMSHVNATVL KVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLVSAIALAYTDKILYSTSH KTH
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0507

STRING: 71421.HI0507

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant HI_0507?

The recommended expression system for HI_0507 is E. coli with an N-terminal His-tag. This approach has been validated to produce full-length protein (amino acids 1-183) with purity exceeding 90% as confirmed by SDS-PAGE analysis. The expression construct should include:

  • A strong inducible promoter (T7 or tac)

  • N-terminal His-tag for purification

  • Appropriate signal sequence if membrane localization is desired

For optimal expression, consider testing multiple E. coli strains (BL21(DE3), Rosetta, or Origami) as membrane proteins often present expression challenges. Induction parameters should be optimized at lower temperatures (16-25°C) to enhance proper folding .

What purification and storage protocols should be followed for HI_0507?

Purification Protocol:

  • Harvest E. coli cells and lyse using appropriate buffer systems containing mild detergents

  • Purify using IMAC (Immobilized Metal Affinity Chromatography) leveraging the His-tag

  • Further purify via size exclusion chromatography if higher purity is required

  • Confirm purity via SDS-PAGE (>90% purity is achievable)

Storage Requirements:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • For reconstituted protein, aliquot to avoid freeze-thaw cycles

  • Short-term storage (up to one week): 4°C in working buffer

  • Long-term storage: Add 5-50% glycerol (optimal: 50%) and store at -20°C/-80°C

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for storage

How should researchers reconstitute and prepare HI_0507 for experimental use?

For optimal reconstitution of lyophilized HI_0507:

  • Briefly centrifuge the vial before opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage preparations, add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

  • Validate protein integrity via SDS-PAGE before experimental use

When designing experiments, consider that HI_0507 is a membrane protein, which may require specific buffer conditions to maintain proper folding and functionality. For functional assays, perform initial validation experiments to determine optimal protein concentration ranges .

What analytical methods are appropriate for characterizing HI_0507?

MethodApplicationTechnical Considerations
SDS-PAGEPurity assessment, molecular weight confirmationUse 12-15% gels for optimal resolution
Western BlotDetection using anti-His antibodiesInclude positive controls and size markers
Circular DichroismSecondary structure analysisBuffer components must be CD-compatible
Mass SpectrometryExact mass determination, PTM identificationConsider detergent removal before analysis
Dynamic Light ScatteringAggregation assessmentFilter samples before measurement
Thermal Shift AssayStability assessmentTest multiple buffer conditions

When performing SDS-PAGE analysis, which is the most commonly reported method for HI_0507, ensure complete denaturation of the sample and use appropriate molecular weight markers. The expected band should appear at approximately 20-22 kDa (accounting for the His-tag) .

How does HI_0507 relate to other virulence factors in H. influenzae?

While direct evidence for HI_0507's role in virulence is still emerging, comparative analysis with other H. influenzae proteins provides context:

  • Protein H (PH): A surface-exposed lipoprotein found in encapsulated H. influenzae type b (Hib) and type f (Hif) that binds factor H, a major regulator of the alternative pathway of complement activation. This interaction is crucial for bacterial resistance against complement activation and pathogenesis .

  • HMW1 Adhesin: A key factor in intracellular invasion by H. influenzae, with transformation of the hmw1 operon resulting in ~1,000-fold increased invasion into airway epithelial cells. This protein facilitates bacterial self-aggregation and adherence to airway cells .

Given that HI_0507 is also a membrane-associated protein, researchers should investigate potential interactions with these better-characterized virulence factors, particularly in the context of host-pathogen interactions .

What genetic manipulation strategies can be employed to study HI_0507 function in H. influenzae?

For in-depth functional analysis of HI_0507, consider these genetic approaches:

  • Gene Deletion/Knockout: Create lph (gene encoding for HI_0507) deletion mutants using homologous recombination or CRISPR-Cas9 systems. Compare phenotypes with wild-type strains to identify functional roles, similar to approaches used for studying Protein H .

  • Transformed Recombinant Enrichment Profiling (TREP): This technique could be particularly valuable, as demonstrated with HMW1. TREP uses natural transformation to generate complex pools of recombinants, followed by phenotypic selection and deep sequencing to identify genetic variations responsible for specific phenotypes .

  • Allelic Replacement: Replace the native hi_0507 gene with tagged or mutated versions to study protein domains and their functions.

  • Complementation Studies: Reintroduce the wild-type gene in knockout strains to confirm phenotype restoration.

These approaches would help establish the specific role of HI_0507 in H. influenzae biology and potential contributions to pathogenesis .

How can researchers investigate potential interactions between HI_0507 and host factors?

To explore potential host-pathogen interactions:

  • Protein-Protein Interaction Studies:

    • Pull-down assays using His-tagged HI_0507

    • Co-immunoprecipitation with potential host targets

    • Surface plasmon resonance to measure binding kinetics

    • Bacterial two-hybrid systems

  • Cell Culture Models:

    • Infection assays using respiratory epithelial cell lines

    • Quantification of adhesion, invasion, and intracellular survival

    • Immunofluorescence to track protein localization during infection

    • Flow cytometry to measure host cell responses

  • Comparative Analysis:

    • Study HI_0507 alongside known virulence factors like Protein H and HMW1

    • Investigate if HI_0507 contributes to complement evasion similar to Protein H

    • Assess if HI_0507 affects bacterial aggregation or adhesion similar to HMW1

These methodologies would provide insights into whether HI_0507 participates in host-pathogen interactions that contribute to H. influenzae colonization or pathogenesis.

What bioinformatic approaches can predict structure-function relationships for HI_0507?

For computational analysis of HI_0507:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with homologs across bacterial species

    • Identification of conserved domains and motifs

    • Prediction of post-translational modifications

    • Signal peptide and transmembrane domain prediction

  • Structural Prediction:

    • Ab initio modeling using tools like AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to study protein flexibility

    • Protein-protein docking with potential interaction partners

    • Identification of potential ligand binding pockets

  • Evolutionary Analysis:

    • Phylogenetic trees to understand evolutionary relationships

    • Analysis of selection pressure on specific residues

    • Identification of co-evolving residues suggesting functional importance

These computational approaches can guide experimental design by highlighting regions of potential functional importance and generating testable hypotheses about HI_0507's role in H. influenzae biology .

How does the structure and function of HI_0507 compare with other characterized H. influenzae membrane proteins?

While detailed structural information about HI_0507 is still emerging, comparative analysis with better-characterized H. influenzae membrane proteins provides valuable context:

ProteinSizeKnown FunctionsLocalizationResearch Applications
HI_0507 (UPF0114)183 aaUnder investigationMembrane-associatedStructure-function studies, potential virulence factor
Protein H (PH)VariableFactor H binding, complement evasionSurface-exposedVirulence studies, vaccine development
HMW1 Adhesin1,536 aaAdhesion, aggregation, intracellular invasionSurface-exposedPathogenesis studies, therapeutic target

Researchers should consider investigating whether HI_0507 shares functional similarities with these better-characterized proteins, particularly in the context of host-pathogen interactions and immune evasion strategies .

What experimental challenges should researchers anticipate when working with HI_0507 compared to other H. influenzae proteins?

Working with membrane proteins like HI_0507 presents specific challenges:

  • Solubility Issues: As a membrane protein, HI_0507 may require detergents or specialized buffer systems to maintain solubility and proper folding.

  • Structural Determination: Membrane proteins typically present greater challenges for structural studies compared to soluble proteins.

  • Functional Assays: Establishing appropriate functional assays may be difficult without clear understanding of the protein's role.

  • Expression Optimization: Expression levels may be lower than for soluble proteins, requiring optimization of expression conditions.

By comparison, proteins like Protein H have established functional assays (Factor H binding) and HMW1 has clear phenotypic outcomes (adhesion, invasion) that facilitate their study. Researchers should develop systematic approaches to characterize HI_0507's function through comparative studies with these better-understood proteins .

What are promising research avenues for elucidating HI_0507 function in H. influenzae pathogenesis?

Future research on HI_0507 should consider these approaches:

  • Systems Biology Integration:

    • Proteomics to identify interaction partners under different conditions

    • Transcriptomics to determine expression patterns during infection

    • Metabolomics to identify pathway alterations in knockout strains

  • In vivo Models:

    • Animal models to compare virulence of wild-type vs. hi_0507 mutants

    • Competitive index assays to measure fitness contributions

    • Tissue-specific expression analysis during infection

  • Structural Biology:

    • Cryo-EM or X-ray crystallography to determine 3D structure

    • Structure-guided mutagenesis to identify functional domains

    • Protein dynamics studies using hydrogen-deuterium exchange mass spectrometry

These approaches would contribute to a comprehensive understanding of HI_0507's role in H. influenzae biology and potential contributions to pathogenesis, building on established methodologies used for other virulence factors .

How might clinical isolates differ in HI_0507 sequence and expression, and what implications might this have?

Understanding HI_0507 variation across clinical isolates is crucial:

  • Sequence Variation Analysis:

    • Compare hi_0507 sequences across clinical isolates from different:

      • Disease manifestations (invasive vs. non-invasive)

      • Body sites (respiratory tract, blood, CSF)

      • Patient populations (age groups, immunocompetent vs. immunocompromised)

  • Expression Level Comparison:

    • Quantify HI_0507 expression in different clinical contexts

    • Identify regulatory mechanisms controlling expression

    • Correlate expression levels with virulence or antibiotic resistance

  • Function Comparison:

    • Assess whether sequence variants have altered functions

    • Determine if specific variants correlate with disease severity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.