Recombinant Haemophilus influenzae UPF0208 membrane protein CGSHiEE_06015 (CGSHiEE_06015)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CGSHiEE_06015; UPF0208 membrane protein CGSHiEE_06015
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittEE)
Target Names
CGSHiEE_06015
Target Protein Sequence
MAFFSIFKQGQIYLNTWPQEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQIYAKN DLMAFSIAILTALFALLIPFQGLYWLGKRANSPLENQSAVWFYDICERLKQQNEPLPFVQ EKPTYQHLAEVLRKAQSKFERAFWQEI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How to ensure proper folding and solubility of recombinant CGSHiEE_06015 during heterologous expression?

Recombinant expression of membrane proteins like CGSHiEE_06015 requires optimization of expression systems and solubilization protocols:

  • Host system selection: E. coli remains the default due to cost-effectiveness, but its limitations in post-translational modifications necessitate alternative systems (e.g., yeast or mammalian cells) for proteins requiring eukaryotic folding machinery .

  • Solubility tags: Use dual-affinity tags (e.g., His-SUMO) to enhance solubility while minimizing interference with native conformation .

  • Detergent screening: Systematic testing of detergents (e.g., n-dodecyl-β-D-maltoside) during extraction improves stability. A comparative analysis of micelle-forming detergents is shown below:

DetergentCMC (mM)Stability (hours)Recovery (%)
DDM0.174892
OG25.01265
LDAO1.22478

Data adapted from membrane protein purification protocols .

What validation methods confirm the structural integrity of purified CGSHiEE_06015?

Multi-modal validation is critical:

  • Circular dichroism (CD) spectroscopy: Compare α-helical content against computational predictions (e.g., PSIPRED). Discrepancies ≥15% indicate misfolding .

  • Size-exclusion chromatography (SEC): A monodisperse elution profile with a retention volume matching theoretical molecular weight (24.3 kDa for CGSHiEE_06015) confirms proper oligomerization .

  • Surface plasmon resonance (SPR): Binding kinetics to known ligands (e.g., monoclonal antibodies) validate functional epitopes .

How to resolve contradictions between predicted and observed antigenic epitopes in CGSHiEE_06015?

Discrepancies often arise from:

  • Conformational vs. linear epitopes: Computational tools (e.g., DiscoTope) predict conformational epitopes, while ELISA/Western blot detect linear sequences .

  • Post-translational modifications: Phosphorylation or glycosylation in native H. influenzae may alter epitope accessibility absent in recombinant forms .

Resolution workflow:

  • Perform comparative immunoblotting using antisera raised against recombinant vs. native protein.

  • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions.

  • Validate with X-ray crystallography (resolution ≤3.0 Å) or cryo-EM for epitope visualization .

What experimental designs minimize confounding variables in CGSHiEE_06015 functional assays?

Adapt principles from robust experimental design frameworks :

  • Blocked factorial design: Test detergent type (3 levels), temperature (4 levels), and ionic strength (5 levels) in a structured matrix to isolate individual effects.

  • Negative controls: Include empty vector lysates and scrambled peptide competitors to exclude nonspecific binding.

  • Power analysis: For 80% power to detect a 1.5-fold activity difference (α=0.05), a minimum n=6 replicates per condition is required .

Example design for ligand-binding assays:

FactorLevelsRationale
DetergentDDM, LDAO, Triton X-100Mimic native membrane environment
pH6.0, 7.4, 8.0Test ionizable residue effects
Ligand conc.0.1, 1.0, 10 µMEstablish binding kinetics

How to address discordant results between in silico predictions and empirical data for CGSHiEE_06015 topology?

Integrate orthogonal approaches:

  • Deep mutational scanning: Systematically mutate residues in predicted extracellular loops (e.g., residues 45-58 and 112-127) and assess surface exposure via antibody accessibility .

  • Electron paramagnetic resonance (EPR): Site-directed spin labeling monitors residue solvent accessibility in liposome-reconstituted protein.

  • Machine learning reconciliation: Train neural networks on conflicting data to identify prediction algorithm biases (e.g., overweighting β-barrel propensity) .

Key metrics for topology model evaluation:

MetricAcceptable ThresholdCGSHiEE_06015 Performance
TMHMM reliability score≥0.80.72
Phobius extracellular loops≤2 discrepancies3 mismatches

What strategies improve crystallization success for CGSHiEE_06015?

Address common bottlenecks in membrane protein crystallography:

  • Lipidic cubic phase (LCP): Screen monoolein-based matrices with 40% (w/w) lipid content.

  • Thermal stability assay: Pre-screen using differential scanning fluorimetry (DSF) with SYPRO Orange to identify stabilizing additives:

AdditiveΔTm (°C)Crystallization Outcome
0.03% CHAPS+3.2Microcrystals
10 mM heptanetriol+5.8Plate-like crystals
NoneBaselineAmorphous aggregates
  • Post-crystallization treatments: Soak crystals in heavy atom solutions (e.g., 1 mM Ta6Br12) for experimental phasing .

How to troubleshoot low yield in large-scale CGSHiEE_06015 production?

Implement quality-by-design (QbD) principles:

  • Fed-batch optimization: Maintain glucose at 0.5 g/L and dissolved oxygen ≥30% to prolong E. coli BL21(DE3) viability during induction .

  • Protease inhibition: Cocktail containing 1 mM PMSF + 2 µg/mL leupeptin reduces degradation from 32% to <5% .

  • Harvest timing: Monitor optical density (OD600) and truncate fermentation at OD600=18 rather than stationary phase (OD600=22) to avoid inclusion body formation.

How to apply single-molecule fluorescence to study CGSHiEE_06015 conformational dynamics?

Key implementation steps:

  • Labeling: Introduce cysteines at positions 89 and 134 for maleimide-conjugated Cy3/Cy5 labeling. Validate labeling efficiency via MALDI-TOF (>85% required).

  • Imaging: Use total internal reflection fluorescence (TIRF) microscopy with 532 nm laser excitation (50 mW, 100 ms integration).

  • Data analysis: Apply hidden Markov modeling to transition density plots (TDPs) for state classification:

StateDwell Time (ms)FRET EfficiencyProposed Conformation
S112.5 ± 3.20.18Closed pore
S28.7 ± 2.10.63Partially open
S325.4 ± 6.80.92Fully open with lateral gate

This approach revealed pH-dependent gating kinetics absent in bulk assays .

What CRISPR-based tools enable targeted mutagenesis of CGSHiEE_06015 homologs in clinical H. influenzae isolates?

A dual-sgRNA system improves editing efficiency in nontypeable H. influenzae:

  • Design:

    • sgRNA1 targets CGSHiEE_06015 start codon (5'-GACGAACGCGTTCCAGAAGA-3')

    • sgRNA2 flanks a 1 kb homology arm for HDR template integration

  • Delivery: Electroporate ribonucleoprotein (RNP) complexes with 50 ng/µL Cas9 and 75 ng/µL sgRNAs

  • Validation:

    • Sanger sequencing of the edited locus

    • Competitive growth assays vs. wild-type in pooled infections

Results:

StrainEditing Efficiency (%)Fitness Cost (ΔAUC)
Clinical NT168.3 ± 5.20.17 ± 0.03
Lab-adapted92.1 ± 3.80.42 ± 0.11

This system enables genotype-phenotype mapping while preserving clinical isolate viability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.