Recombinant Haemophilus influenzae UPF0208 membrane protein HI_1205 (HI_1205)

Shipped with Ice Packs
In Stock

Description

Applications in Biomedical Research

HI_1205 serves as a critical tool in studying bacterial membrane biology and pathogenesis. Key applications include:

ApplicationPurpose
ELISA AssaysDetection of anti-H. influenzae antibodies or protein-protein interactions
Western BlottingValidation of protein expression or interaction partners
ImmunohistochemistryLocalization of HI_1205 in bacterial membranes or host cells
Antibody DevelopmentProduction of specific antibodies for diagnostic or therapeutic research

Research Context and Functional Insights

While direct functional studies on HI_1205 remain limited, its classification as a UPF0208 family membrane protein suggests potential roles in:

  • Membrane Integrity: Likely involved in maintaining structural or transport functions in H. influenzae membranes .

  • Antimicrobial Resistance: Part of broader studies on H. influenzae resistance mechanisms, as MDR strains show rising prevalence (e.g., beta-lactamase production doubling since 2003) .

Challenges and Knowledge Gaps

Current limitations include:

  • Functional Ambiguity: No explicit biochemical functions (e.g., enzyme activity or substrate specificity) are documented in public databases .

  • Pathway Involvement: Pathways or interacting proteins remain uncharacterized due to insufficient experimental data .

  • Therapeutic Relevance: No direct evidence links HI_1205 to disease mechanisms in H. influenzae infections, though membrane proteins are targets in antibiotic development .

Comparative Analysis of Recombinant HI_1205 Products

Commercially available HI_1205 variants differ in production systems and host species:

ProductHostPurityKey Features
RFL33991HF E. coli>90%Full-length, His-tagged, optimized for SDS-PAGE
CSB-CF337665HTA E. coliNot specifiedELISA-compatible, Tris-based buffer
MBS1122786 Cell-free systems≥85%Partial-length variants available

Implications for Future Research

HI_1205’s utility lies in its role as a model for studying H. influenzae membrane biology. Future directions include:

  • Protein Interaction Mapping: Identifying binding partners via pull-down assays or yeast two-hybrid systems .

  • Structural Analysis: Determining its 3D structure to infer functional domains.

  • Antibiotic Target Validation: Assessing its role in resistance mechanisms (e.g., β-lactamase regulation) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HI_1205; UPF0208 membrane protein HI_1205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1205
Target Protein Sequence
MAFFSIFKQGQIYLNTWPLEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQFYAKN DLMAFSIAILTALFALLIPFQGLYWLGKRANTPLENQSAVWFYDICERLKQLHEPLPFVQ EKPTYQHLAEVLKKAQSKLERAFWQEI
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1205

STRING: 71421.HI1205

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant HI_1205 be stored and handled for optimal stability?

Proper storage and handling of recombinant HI_1205 is crucial for maintaining protein integrity and experimental reproducibility. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For storage:

  • Store unopened vials at -20°C to -80°C upon receipt

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • For working solutions, store aliquots at 4°C for up to one week

This approach minimizes protein degradation while maintaining functionality for experimental applications.

What detection methods are most effective for HI_1205 in experimental settings?

Several detection methods can be employed for HI_1205, with selection depending on the specific research question:

Detection MethodApplicationAdvantage
SDS-PAGEBasic protein detectionConfirms size and purity of recombinant protein
Western BlottingProtein expression verificationAllows detection of HI_1205 in bacterial lysates or during interaction studies
ELISAQuantitative detectionEnables measurement of protein-protein interactions or antibody response
ImmunohistochemistryLocalization studiesDetermines spatial distribution within bacterial membranes

For initial characterization, SDS-PAGE provides confirmation of protein size and purity, while immunological techniques like Western blotting offer specificity through the His-tag or using anti-HI_1205 antibodies when available. When designing experiments, consider that membrane proteins may require specialized detergent-based buffers to maintain solubility during these procedures.

What experimental approaches are recommended for investigating potential functions of HI_1205?

Given the functional ambiguity surrounding HI_1205, a multi-faceted experimental approach is necessary:

  • Comparative Genomics Analysis: Align HI_1205 with homologous proteins from related bacterial species to identify conserved domains that might suggest function.

  • Gene Knockout Studies: Create HI_1205 deletion mutants in H. influenzae following methods similar to those used for other H. influenzae membrane proteins . This allows assessment of phenotypic changes in:

    • Growth characteristics in various media

    • Membrane integrity using permeability assays

    • Resistance to antimicrobial compounds

    • Virulence in infection models

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with His-tagged HI_1205

    • Bacterial two-hybrid systems

    • Mass spectrometry identification of binding partners

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-electron microscopy to determine 3D structure

    • In silico modeling based on structurally characterized UPF0208 family members

These approaches should be designed with appropriate controls following systematic experimental design principles, including variable definition, hypothesis development, and rigorous control of extraneous variables .

How might HI_1205 compare functionally to other characterized membrane proteins in H. influenzae?

While specific functions of HI_1205 remain undetermined, comparative analysis with other H. influenzae membrane proteins offers potential insights:

  • Membrane Integrity: HI_1205 may contribute to membrane structure or transport functions, similar to other bacterial transmembrane proteins.

  • Antimicrobial Resistance: The protein could participate in resistance mechanisms, particularly relevant given that multidrug-resistant H. influenzae strains have shown increasing prevalence with beta-lactamase production doubling since 2003.

  • Environmental Sensing: As a membrane protein, HI_1205 might function in environmental signal transduction pathways.

Experimental comparison with functionally characterized H. influenzae membrane proteins would require parallel gene knockout studies, phenotypic assays, and protein interaction analyses to identify functional relationships or redundancies.

What challenges exist in designing expression systems for functional studies of HI_1205?

Membrane proteins present unique challenges for recombinant expression and functional characterization:

  • Expression Optimization:

    • Current protocols utilize E. coli expression systems with N-terminal His tags

    • Alternative expression systems (Pichia pastoris, insect cells) might yield protein with improved native folding

    • Codon optimization for the expression host may improve yields

    • Induction conditions (temperature, IPTG concentration, time) require optimization

  • Solubilization Strategies:

    • Membrane proteins require detergent screening to identify optimal solubilization conditions

    • Mild detergents (DDM, LDAO) often preserve protein structure but extraction efficiency varies

    • Nanodiscs or amphipols might better mimic native membrane environment

  • Functional Assay Development:

    • Without known function, activity assays must be designed based on structural predictions

    • Transport functions would require reconstitution into liposomes

    • Binding assays need potential ligands identified through bioinformatic prediction

  • Structural Considerations:

    • Transmembrane regions may impede crystallization

    • Detergent micelles can complicate structural analysis

These challenges necessitate iterative optimization of expression and purification protocols before functional characterization can proceed reliably.

What is the optimal protocol for using HI_1205 in immunological detection systems?

When utilizing HI_1205 in immunological applications, researchers should consider the following protocol adaptations:

For ELISA Applications:

  • Plate Coating: Dilute purified HI_1205 to 1-10 μg/mL in carbonate buffer (pH 9.6)

  • Incubate plates overnight at 4°C

  • Block with 1-5% BSA in PBS-T for 1-2 hours at room temperature

  • Apply primary antibodies or test sera in dilution buffer

  • Detect using appropriate enzyme-conjugated secondary antibodies

  • Develop with substrate and measure optical density

For Western Blotting:

  • Sample Preparation: Add SDS sample buffer to recombinant HI_1205 or bacterial lysates

  • Heat samples at 95°C for 5 minutes (note: membrane proteins may form aggregates at high temperatures; consider 70°C for 10 minutes)

  • Separate proteins on 12-15% SDS-PAGE (appropriate for 147aa protein with tag)

  • Transfer to PVDF membrane (recommended over nitrocellulose for membrane proteins)

  • Block with 5% non-fat dry milk in TBS-T

  • Probe with anti-His antibody (1:1000-1:5000) or specific anti-HI_1205 antibodies

  • Detect using enhanced chemiluminescence

These approaches enable detection of HI_1205 in various experimental contexts, supporting both basic characterization and advanced studies of protein interactions.

How can researchers design knockout studies to assess HI_1205 function in H. influenzae?

  • Knockout Strategy Design:

    • Create precise deletion of the lph gene (HI_1205 coding sequence) using homologous recombination

    • Design knockout constructs with 500-1000bp homology arms flanking the target gene

    • Include selectable marker (e.g., kanamycin resistance) for transformant selection

    • Consider creating complemented strains to confirm phenotype specificity

  • Transformation Protocol:

    • Prepare competent H. influenzae cells at early log phase

    • Transform with linearized knockout construct using standard methods

    • Select transformants on antibiotic-containing media

    • Confirm deletion by PCR and sequencing

  • Phenotypic Characterization:

    • Growth curve analysis in standard and stress conditions

    • Membrane integrity assays (e.g., propidium iodide uptake)

    • Antimicrobial susceptibility testing

    • Biofilm formation capability

    • Host cell adhesion and invasion assays

    • Complement resistance testing (similar to PH protein studies )

  • Experimental Controls:

    • Include wild-type strain in all assays

    • Use complemented mutant to confirm phenotype restoration

    • Consider testing against known membrane protein mutants

This approach follows principles of systematic experimental design while addressing potential confounding variables .

What analytical methods can determine if HI_1205 interacts with host immune factors?

Given that some H. influenzae membrane proteins like PH interact with host immune factors, investigating whether HI_1205 has similar properties requires multiple analytical approaches:

  • Direct Binding Assays:

    • ELISA-based binding assays with immobilized HI_1205 and purified host factors

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Microscale Thermophoresis for solution-based interaction studies

    • Pull-down assays using His-tagged HI_1205 as bait

  • Functional Immune Assays:

    • Serum bactericidal assays comparing wild-type and HI_1205 knockout strains

    • Complement deposition assays using flow cytometry

    • Phagocytosis assays with human neutrophils or macrophages

  • Structural Analysis of Interactions:

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

    • X-ray crystallography of HI_1205-immune factor complexes

  • In vivo Relevance:

    • Animal infection models comparing virulence of wild-type and knockout strains

    • Tissue-specific bacterial burden assessment

This systematic approach allows researchers to determine if HI_1205, like other H. influenzae membrane proteins, contributes to immune evasion through specific interactions with host factors .

What are the current knowledge gaps regarding HI_1205 function and structure?

Despite availability of recombinant HI_1205 for research applications, significant knowledge gaps exist:

  • Functional Characterization:

    • No specific biochemical function has been established

    • Enzymatic activity, if any, remains uncharacterized

    • Substrate specificity is unknown

    • Contribution to H. influenzae virulence is undetermined

  • Structural Information:

    • Three-dimensional structure has not been resolved

    • Membrane topology prediction requires experimental validation

    • Post-translational modifications in the native protein are uncharacterized

  • Protein Interactions:

    • Interaction partners remain unidentified

    • Participation in protein complexes is speculative

    • Integration in signaling or metabolic pathways is undocumented

  • Regulation:

    • Transcriptional and translational regulation mechanisms are unknown

    • Environmental factors affecting expression have not been systematically studied

These gaps present opportunities for researchers to make significant contributions to understanding this conserved bacterial membrane protein and its potential role in pathogenesis.

How might advanced proteomics approaches enhance our understanding of HI_1205?

Advanced proteomics techniques offer promising avenues to resolve current limitations in HI_1205 research:

  • Interactome Analysis:

    • Proximity-dependent biotin identification (BioID) with HI_1205 as bait

    • Cross-linking mass spectrometry to capture transient interactions

    • Quantitative proteomics comparing wild-type and knockout strains

  • Post-Translational Modifications:

    • Phosphoproteomics to identify potential regulatory phosphorylation sites

    • Glycoproteomics to detect potential glycosylation in the native protein

    • Redox proteomics to assess cysteine oxidation states

  • Membrane Localization:

    • Quantitative membrane proteomics to determine sub-membrane localization

    • Super-resolution microscopy with fluorescently-tagged HI_1205

    • Domain-specific labeling for topology mapping

  • Conformational Dynamics:

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

    • Ion mobility mass spectrometry for structural characterization

    • Native mass spectrometry to assess oligomeric states

These approaches could reveal functional associations and structural characteristics that conventional methods have failed to identify, potentially positioning HI_1205 within specific bacterial pathways or virulence mechanisms.

What experimental design considerations are most critical when studying poorly characterized membrane proteins like HI_1205?

When investigating functionally ambiguous membrane proteins such as HI_1205, several critical experimental design considerations should be incorporated:

  • Hypothesis Development:

    • Frame specific, testable hypotheses based on bioinformatic predictions

    • Consider evolutionary conservation patterns when developing functional hypotheses

    • Design experiments that can distinguish between alternative functional models

  • Variable Control:

    • Identify and control all potential extraneous variables that might influence results

    • Carefully document bacterial growth conditions, protein expression parameters, and experimental conditions

    • Use multiple bacterial strains to account for strain-specific effects

  • Multi-method Validation:

    • Employ complementary techniques to verify observations

    • Validate protein-protein interactions using at least three independent methods

    • Confirm functional observations using both in vitro and in vivo approaches

  • Negative Controls:

    • Include appropriate negative controls in all binding studies

    • Use structurally similar but functionally distinct membrane proteins as controls

    • Design control experiments that can detect experimental artifacts

  • Replication Strategy:

    • Implement both technical and biological replication

    • Calculate appropriate sample sizes based on expected effect sizes

    • Pre-register experimental protocols to minimize bias

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.