Recombinant Haemophilus influenzae UPF0208 membrane protein NTHI1376 (NTHI1376)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus influenzae and NTHI1376

Haemophilus influenzae is a bacterium known to cause a variety of infectious diseases, particularly in children, such as meningitis, pneumonia, and otitis media . Nontypeable Haemophilus influenzae (NTHi) strains, which lack a polysaccharide capsule, are a primary cause of bacterially induced acute exacerbations of chronic obstructive pulmonary disease (COPD) . NTHi adheres to and invades host respiratory epithelial cells, allowing it to persist in the lower airways of adults with COPD .

NTHI1376 refers to a specific protein within Haemophilus influenzae. Further details about its function, structure, and role are not available in the provided context.

NTHI1441 as a Virulence Factor

NTHI1441, another protein in Haemophilus influenzae, has been identified as a virulence factor contributing to the bacterium's ability to invade human respiratory epithelial cells . An isogenic knockout mutant of the open reading frame NTHI1441 showed a significant reduction (76.6% ± 5.5%) in the invasion of human bronchial and alveolar epithelial cells . The decreased invasion occurred independently of intracellular survival or adherence to cells .

2.1. Conservation and Expression

The NTHI1441 gene is conserved among NTHi genomes and does not change during persistence in the airways of individuals with COPD . The NTHI1441 protein expresses extracellular epitopes on the bacterial cell surface and is a target of serum antibodies following infection in adults with COPD, suggesting its expression during infection of the human respiratory tract .

2.2. Potential Therapeutic Target

Due to its role in host cell invasion, conservation among strains, and expression of surface-exposed epitopes, NTHI1441 is considered a potential target for preventative and therapeutic interventions for diseases caused by NTHi .

Protein Structure Overview

Proteins are composed of amino acids linked by peptide bonds, and their structure can be described at four levels .

Protein Structure Prediction

Protein structure prediction involves inferring the three-dimensional structure of a protein from its amino acid sequence . The conformational flexibility around the torsion angles φ and ψ at the Cα atom allows for many possible arrangements of the polypeptide chain . Interactions such as hydrogen bonding between the main chain NH and CO groups contribute to the formation of secondary structures like α helices and β sheets .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NTHI1376; UPF0208 membrane protein NTHI1376
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
NTHI1376
Target Protein Sequence
MAFFSIFKQGQIYLNTWPQEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQIYAKN DLMAFSIAILTALFALLIPFQGLYWLGKRANSPLENQSAVWFYDICERLKQQNEPLPFVQ EKPTYQHLAEVLRKAQSKFERAFWQEI
Uniprot No.

Target Background

Database Links

KEGG: hit:NTHI1376

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.