Recombinant Haemophilus influenzae UPF0283 membrane protein CGSHiGG_02710 (CGSHiGG_02710)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CGSHiGG_02710 is annotated as a UPF0283 family membrane protein with unknown precise biological function. Its recombinant form includes the full-length sequence (1-354 amino acids) fused to an N-terminal hexahistidine (His) tag for purification .

Expression and Purification

The protein is produced in E. coli expression systems, followed by affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resins targeting the His tag .

Quality Control Metrics:

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
StabilityLyophilized powder stable at -20°C/-80°C; avoid repeated freeze-thaw cycles .

Vaccine Development

CGSHiGG_02710 is investigated as a potential antigen for vaccines against H. influenzae, particularly non-typeable strains (NTHi) that lack a polysaccharide capsule and evade traditional vaccines . Its membrane localization suggests involvement in host-pathogen interactions, making it a target for antibody-mediated neutralization .

Functional Studies

  • Pathogenicity Mechanisms: Studies focus on its role in bacterial adhesion, biofilm formation, or immune evasion .

  • Structural Biology: Used in crystallography or cryo-EM to resolve 3D structures for drug design .

Diagnostic Tools

Commercial ELISA kits utilize this recombinant protein to detect H. influenzae-specific antibodies in patient sera .

Product Comparison Table

VendorSourceTagFormPrice (Approx.)
Creative BioMart E. coliHis-tagLyophilized$800/50 µg
Creative Biolabs E. coliVariableLiquid$1,200/100 µg
Colorectal Research E. coliVariableLyophilized$950/50 µg

Notes:

  • Products are labeled "For Research Use Only" and not approved for human therapeutics .

  • Reconstitution protocols recommend glycerol addition (5–50%) for long-term storage .

Clinical Relevance

  • Invasive Diseases: Meningitis, bacteremia, and pneumonia caused by H. influenzae have a 3–6% mortality rate in children and up to 20% risk of neurological sequelae .

  • Vaccine Gaps: Existing Hib vaccines target type b strains, leaving non-typeable and other serotypes (a, c–f) underserved .

Future Directions

  • Epitope Mapping: Identify immunodominant regions for subunit vaccine design.

  • Antimicrobial Discovery: Screen inhibitors targeting CGSHiGG_02710’s membrane-integrated domains.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CGSHiGG_02710; UPF0283 membrane protein CGSHiGG_02710
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittGG)
Target Names
CGSHiGG_02710
Target Protein Sequence
MEKQIFEHSVNVEEEHYQPKQEFHNMEAKLDEALDGELLDAQLEQALKPKSSFRKTLLKF TALLFGLATVAQSVQWIWDSYQQHQWIYLAFALVSLIIILLGIKEIICEWRRLVRLKKRE QLQQQSQQIWLESAVKNGDVFSVHNAEKSKILCLDIAKSLGLENDSPAVIQWQHQLNEAY SAQEIAHLFSRHVLSSFDAQAKKLISKMAAESAVIVAISPLAVVDMFFIAWRNLRLMNKI AEIYGIELGYFSRIRLLRMVLVNIAFAGATEVAQDIGMDWLSQDVTAKLSTRIAQGIGVG LLTARLGVKAMELCRPLAFQLNEKPKLSYIQQELLSSVKDIVLGKNKIYKKEQI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 membrane protein CGSHiGG_02710?

UPF0283 membrane protein CGSHiGG_02710 is a transmembrane protein found in Haemophilus influenzae, a gram-negative coccobacillary bacterium that commonly inhabits the upper respiratory tract and can cause serious infections of mucosal surfaces . The protein belongs to the UPF0283 protein family, which consists of uncharacterized membrane proteins with predicted multiple transmembrane domains. AlphaFold computational modeling suggests a confident structural prediction with a global pLDDT score of 72.14, indicating a moderately reliable predicted structure . The protein's full length consists of 354 amino acids and is encoded by the CGSHiGG_02710 gene in Haemophilus influenzae .

What expression systems are commonly used for producing recombinant UPF0283 membrane protein?

Several expression systems have been validated for the production of recombinant UPF0283 membrane protein CGSHiGG_02710, each offering specific advantages depending on research requirements:

Expression SystemAdvantagesTypical YieldNotes
E. coliHigh yield, cost-effective, rapid expressionVariable (mg/L range)Most commonly used system; often requires optimization of culture conditions
YeastPost-translational modifications, proper protein foldingModerateSuitable for complex membrane proteins
BaculovirusEukaryotic processing, high-level expressionHighPreferred for structural studies
Mammalian CellNative-like folding and post-translational modificationsLower than other systemsUsed when authentic eukaryotic modifications are essential

For optimal expression in E. coli, researchers have successfully employed T7-inducible promoter systems with IPTG induction, which has been shown to yield high levels of phosphomonoesterase activity after purification through multiple chromatography steps . Expression in E. coli typically involves fusion to an N-terminal His-tag to facilitate purification by affinity chromatography .

What are the optimal storage conditions for recombinant UPF0283 membrane protein?

Based on empirical studies, the following storage protocol has been established for maintaining stability and activity of recombinant UPF0283 membrane protein:

For long-term storage, the purified protein should be stored at -20°C/-80°C in aliquots to prevent repeated freeze-thaw cycles, which can significantly compromise protein integrity . The optimal storage buffer consists of Tris/PBS-based buffer at pH 8.0 with 6% trehalose . For working solutions, it is recommended to add glycerol to a final concentration of 50%, though concentrations between 5-50% have been used successfully . For reconstitution, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL . Working aliquots can be maintained at 4°C for up to one week without significant degradation .

How can researchers purify recombinant UPF0283 membrane protein while maintaining its native structure?

Purification of recombinant UPF0283 membrane protein requires careful consideration of the protein's transmembrane nature. The following methodology has been empirically validated:

  • Expression optimization: Use T7-inducible promoter systems with IPTG induction in E. coli, replacing the N-terminal lipid modification signal sequence with one for protein secretion .

  • Cell lysis protocol:

    • Harvest cells by centrifugation (5,000g, 15 minutes, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, and protease inhibitors

    • Disrupt cells using sonication or French press under cooling conditions

  • Membrane protein extraction:

    • Add detergent (typically 1% n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Remove insoluble material by centrifugation (100,000g, 1 hour, 4°C)

  • Chromatography steps:

    • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

    • Size exclusion chromatography to separate monomeric protein from aggregates

This approach yields protein with high purity (>90% as determined by SDS-PAGE) while maintaining physicochemical properties similar to the wild-type protein, including substrate specificity and pH optimum .

What techniques are most effective for studying UPF0283 membrane protein structure?

Structural analysis of UPF0283 membrane protein requires an integrated approach combining computational prediction with experimental validation:

TechniqueApplicationResolutionAdvantages/Limitations
AlphaFold2 predictionInitial structure hypothesisVariable (pLDDT score-dependent)Provides starting model; requires experimental validation
X-ray crystallographyHigh-resolution structurePotentially atomic resolutionChallenging for membrane proteins; requires crystal formation
Cryo-electron microscopy3D structure determination2-4 Å possibleDoes not require crystallization; suitable for membrane proteins
NMR spectroscopyDynamic structure analysisResidue-levelLimited by protein size; good for dynamics studies
Hydrogen-deuterium exchange MSStructural dynamicsPeptide-levelProvides information on solvent accessibility

Current computational models of UPF0283 membrane protein show a global pLDDT score of 72.14-74.1, placing it in the "Confident" prediction category (70 < pLDDT ≤ 90) . The prediction suggests a multi-pass transmembrane architecture, but experimental validation through techniques like cryo-EM would be necessary to confirm this structural arrangement.

How does UPF0283 membrane protein relate to bacterial pathogenesis?

While the specific function of UPF0283 membrane protein in pathogenesis is not fully characterized, contextual evidence suggests potential roles based on its properties and bacterial localization:

Haemophilus influenzae is responsible for various infections ranging from localized to invasive conditions, including meningitis, septicemia, and epiglottitis . As a membrane protein in this pathogen, UPF0283 may contribute to:

  • Membrane integrity: The protein's predicted multi-pass transmembrane structure suggests a role in maintaining bacterial membrane stability under varying environmental conditions .

  • Transport functions: Based on structural similarities to other bacterial membrane proteins, it may facilitate transport of essential nutrients or export of virulence factors .

  • Host cell interactions: Surface-exposed domains could potentially interact with host cell receptors or contribute to adhesion mechanisms, particularly given that H. influenzae strains isolated from patients with acute bronchopulmonary diseases demonstrate higher adhesive activities than those from healthy carriers .

  • Stress response: The protein might participate in bacterial adaptation to varying host environments, potentially contributing to persistence during chronic infection .

Research examining UPF0283 knockout strains in infection models would be valuable for definitively establishing its role in pathogenesis.

How can transformed recombinant enrichment profiling (TREP) be applied to study UPF0283 membrane protein function?

Transformed recombinant enrichment profiling (TREP) represents a powerful approach for investigating UPF0283 membrane protein function through the following methodology:

  • Generation of recombinant pools:

    • Use natural transformation to introduce sequence variants of the CGSHiGG_02710 gene into recipient Haemophilus influenzae strains

    • Create complex pools of recombinants with varying UPF0283 protein sequences

  • Phenotypic selection:

    • Apply selective pressure related to hypothesized protein function (e.g., membrane stability, transport capacity)

    • Enrich for recombinants with enhanced function

  • Deep sequencing analysis:

    • Sequence the enriched recombinant population

    • Identify genetic variations associated with functional enhancement

This approach, similar to that used to identify HMW1 as an intracellular invasion locus in H. influenzae , could reveal functional domains within UPF0283 and potentially identify interaction partners. The methodology is particularly valuable because it allows investigation of protein function within the native cellular context rather than in artificial systems.

How does UPF0283 membrane protein from H. influenzae compare with homologs in other bacteria?

Comparative analysis of UPF0283 membrane proteins across bacterial species reveals evolutionary relationships and functional implications:

OrganismProtein IDSequence LengthGlobal pLDDT ScoreSequence Identity to H. influenzaeNotable Features
Haemophilus influenzaeCGSHiGG_02710354 aa72.14100%Multiple transmembrane domains
Photobacterium profundum SS9Q6LPF8348 aa72.14~35-40%Similar membrane topology
Escherichia coli APEC O1YcjF (A1AAT4)353 aa74.1~30-35%Slightly higher model confidence

The UPF0283 protein family appears to be widely distributed among Gram-negative bacteria, with particular conservation in the Gammaproteobacteria class. The maintenance of this protein across diverse ecological niches (from human pathogens to deep-sea bacteria like P. profundum) further suggests it performs a basic cellular function rather than a specialized role in pathogenesis.

What methodological challenges exist when studying membrane protein interactions involving UPF0283?

Investigating membrane protein interactions presents unique methodological challenges that require specialized approaches:

  • Membrane environment reconstitution:

    • Challenge: Maintaining native-like lipid environment for proper protein folding and interactions

    • Solution: Use of nanodiscs, liposomes, or detergent micelles to mimic membrane environment

    • Consideration: Different lipid compositions may affect interaction dynamics

  • Protein-protein interaction detection:

    • Challenge: Traditional methods (e.g., yeast two-hybrid) are poorly suited for membrane proteins

    • Solution: Membrane-specific methods such as MYTH (membrane yeast two-hybrid) or split-ubiquitin systems

    • Consideration: Validation across multiple methods is essential due to high false-positive rates

  • Structural analysis of complexes:

    • Challenge: Obtaining high-resolution structures of membrane protein complexes

    • Solution: Integrative approaches combining cryo-EM, crosslinking mass spectrometry, and computational modeling

    • Consideration: Limited by current resolution capabilities for dynamic complexes

For UPF0283 specifically, its relatively high pLDDT confidence scores (72.14-74.1) suggest that computational approaches might provide useful initial insights into potential interaction interfaces, which could then guide targeted experimental validation.

How might artificial intelligence approaches enhance our understanding of UPF0283 membrane protein?

Artificial intelligence and machine learning approaches offer promising avenues for advancing UPF0283 membrane protein research through multiple strategies:

  • Structure prediction refinement:

    • Current AlphaFold2 predictions provide confidence scores of 72.14-74.1 for UPF0283 proteins

    • Integration of experimental constraints (crosslinking data, HDX-MS) with AI models could further refine structural predictions

    • Specially designed membrane protein-specific AI models may better account for the lipid bilayer environment

  • Function prediction through deep learning:

    • Advanced neural networks trained on known membrane protein functions could identify potential roles for UPF0283

    • Analysis of conserved structural motifs across the protein family using graph neural networks

    • Integration of genomic context and expression data to predict functional associations

  • Drug interaction modeling:

    • AI-driven virtual screening could identify potential small molecules that interact with UPF0283

    • Molecular dynamics simulations guided by machine learning could reveal dynamic binding sites

    • Generative models might design precision inhibitors or modulators for functional studies

These approaches could help bridge the gap between the increasingly available structural data and the limited functional characterization of UPF0283 membrane proteins.

What potential applications might emerge from detailed characterization of UPF0283 membrane protein?

Complete characterization of UPF0283 membrane protein could lead to several valuable applications:

  • Antimicrobial development:

    • If proven essential for H. influenzae viability, UPF0283 could become a novel target for antimicrobial compounds

    • The protein's conserved nature across bacterial species suggests potential broad-spectrum applications

    • Structural insights could facilitate structure-based drug design targeting specific functional domains

  • Vaccine development:

    • As a membrane protein in H. influenzae, exposed domains could serve as antigenic targets

    • Recombinant versions of UPF0283 extracellular domains might function as vaccine components

    • Their inclusion in multi-component vaccines could enhance protection against H. influenzae infections

  • Membrane protein engineering platforms:

    • Insights from UPF0283 structure could inform the design of artificial membrane proteins

    • Similar to recent advances in transmembrane protein design , UPF0283 structural motifs might serve as templates

    • Applications could include designed channels, sensors, or cellular signaling modules

  • Diagnostic tools:

    • Antibodies against UPF0283 could potentially serve in diagnostic assays for H. influenzae

    • Detection systems targeting the encoding gene might enhance molecular diagnostics

    • Potential biomarker for specific infection states or bacterial persistence

As research progresses from basic characterization to applied science, UPF0283 membrane protein could transition from an uncharacterized protein family to a valuable component in multiple biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.