Recombinant Haemophilus influenzae UPF0283 membrane protein HI_0043 (HI_0043)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
HI_0043; UPF0283 membrane protein HI_0043
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0043
Target Protein Sequence
MEKQIFEHSVNVEEEHYQPKQEFHNMEAKLDEALDGELLDAQLEQALKPKSSFRKTLLKF TALLFGLATVAQSVQWIWDSYQKHQWIYLAFALVSLIIILLGIKEIICEWRRLVRLKKRE QWQQQSQQIWLESAVKNGDVFSVHNAEKSKILCLDIAKSLGLENDSPTVIQWQHQLNEAY SAQEIAHLFSRHVLSSFDAQAKKLISKMAAESAVIVAISPLAVVDMFFIAWRNLRLMNKI AEIYGIELGYFPRIRLLRMVLVNIAFAGATEVAQDIGMDWLSQDVTAKLSTRIAQGIGVG LLTARLGVKAMELCRPLAFQLNEKPKLSHIQQELLSSVKDIVLGKNKIYKKEQI
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0043

STRING: 71421.HI0043

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the HI_0043 protein and its role in Haemophilus influenzae?

HI_0043 is a membrane protein belonging to the UPF0283 protein family found in Haemophilus influenzae, a Gram-negative human pathogen that primarily resides in the upper respiratory tract. While the specific function of HI_0043 remains under investigation, it represents one of several membrane proteins that may play roles in bacterial pathogenesis. Haemophilus influenzae is known to employ various membrane proteins as part of its strategy to circumvent host immune responses, particularly against the bactericidal effects of the complement system . The UPF0283 designation indicates that this is a protein of unknown function from family 0283, suggesting it has homologs in other bacterial species but with limited functional characterization to date.

To begin characterizing HI_0043, researchers should consider sequence analysis using bioinformatics tools to identify conserved domains, predicted transmembrane regions, and potential functional motifs. This computational approach should be followed by experimental confirmation of membrane localization using cellular fractionation techniques and Western blot analysis with anti-HI_0043 antibodies.

What are the optimal expression systems for recombinant production of HI_0043?

Recombinant HI_0043 can be expressed and purified from various host systems, with E. coli and yeast offering the best yields and shorter turnaround times for basic characterization studies . For functional studies requiring post-translational modifications, expression in insect cells with baculovirus or mammalian cell systems may be more appropriate as these can provide many of the post-translational modifications necessary for correct protein folding or retention of biological activity .

The methodological approach should include:

  • Gene optimization: Codon optimization for the chosen expression host to enhance translation efficiency

  • Vector selection: Use of vectors with strong, inducible promoters such as T7 for E. coli systems, similar to approaches used for other H. influenzae recombinant proteins

  • Fusion tags: Incorporation of affinity tags (His, FLAG, MBP, GST) to facilitate purification and potentially improve solubility

  • Expression conditions: Optimization of temperature, induction timing, and media composition

Expression SystemAdvantagesDisadvantagesRecommended for
E. coliHigh yields, rapid growth, cost-effectiveLimited post-translational modificationsInitial characterization, structural studies
YeastGood yields, some post-translational modificationsLonger production time than E. coliFunctional studies requiring some modifications
Insect cellsMore complex modifications, proper foldingHigher cost, slower productionAdvanced functional studies
Mammalian cellsNative-like modificationsHighest cost, lowest yieldsCritical functional assays

What strategies can overcome expression challenges for HI_0043 as a membrane protein?

As a membrane protein, HI_0043 may present challenges during recombinant expression, including toxicity to host cells, protein aggregation, and improper folding. Several methodological approaches can address these issues:

  • Utilize specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3)

  • Consider a dual-plasmid system with the target gene and chaperone proteins to assist proper folding

  • Employ fusion partners known to enhance membrane protein solubility, such as MBP or Mistic

  • Optimize expression conditions by testing different temperatures (typically 16-30°C), inducer concentrations, and growth media

  • For particularly difficult constructs, cell-free expression systems can be considered as an alternative approach

When expressing membrane proteins like HI_0043, replacing the native signal sequence with one optimized for the host system can improve targeting to the membrane, similar to the approach used for other H. influenzae lipoproteins where the N-terminal lipid modification signal sequence was replaced with one for protein secretion without such modification .

What is the recommended purification protocol for recombinant HI_0043?

Purification of recombinant HI_0043 typically requires a multi-step approach to achieve high purity while maintaining protein structure and function. Based on established protocols for similar membrane proteins, the following methodological workflow is recommended:

  • Membrane isolation: Harvest cells and disrupt by sonication or French press, followed by differential centrifugation to isolate membrane fractions

  • Solubilization: Extract HI_0043 from membranes using appropriate detergents (test multiple options including DDM, LDAO, or CHAPS)

  • Affinity chromatography: Utilize the fusion tag (commonly His-tag) for initial purification using IMAC (Immobilized Metal Affinity Chromatography)

  • Secondary purification: Apply size exclusion chromatography to remove aggregates and achieve higher purity

  • Optional tag removal: If necessary, remove fusion tags using specific proteases

For HI_0043, a two-step chromatography approach (affinity followed by size exclusion) should be sufficient to achieve apparent homogeneity, similar to the purification strategies used for other recombinant H. influenzae proteins . The purification process should be monitored by SDS-PAGE and Western blotting to confirm identity and purity.

How can researchers assess the structural integrity of purified HI_0043?

Verifying the structural integrity of purified HI_0043 is crucial for downstream functional studies. The following analytical approaches are recommended:

  • SDS-PAGE analysis: To determine apparent molecular weight and purity

  • Size exclusion chromatography: To assess oligomeric state and homogeneity

  • Circular dichroism (CD) spectroscopy: To confirm secondary structure content

  • Thermal shift assays: To evaluate protein stability under various buffer conditions

  • Limited proteolysis: To probe the folded state and domain organization

  • Dynamic light scattering: To check for aggregation and homogeneity

For membrane proteins like HI_0043, it's particularly important to verify that the protein remains stable in the chosen detergent system. Testing multiple detergents and monitoring protein stability over time using the above techniques will help identify optimal conditions for long-term storage and functional assays.

What experimental approaches can determine the function of HI_0043?

Given that HI_0043 belongs to the UPF0283 family with unknown function, a systematic approach to functional characterization is necessary:

  • Comparative genomics analysis: Identify conserved genomic context and co-expressed genes

  • Gene knockout studies: Create HI_0043 deletion mutants and assess phenotypic changes in growth, morphology, and virulence

  • Protein-protein interaction studies: Use pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation to identify interaction partners

  • Lipid binding assays: Test interaction with various lipids using liposome binding assays

  • Structure determination: X-ray crystallography or cryo-EM to gain insights into potential function based on structural features

Since Haemophilus influenzae membrane proteins often play roles in host immune evasion, particularly against complement-mediated killing , testing HI_0043 deletion mutants for altered sensitivity to human serum could provide functional insights. Additionally, examining whether HI_0043, like the identified Protein H (PH), interacts with host factors would be valuable in understanding its potential role in pathogenesis.

How can researchers investigate potential interactions between HI_0043 and host factors?

To identify and characterize potential interactions between HI_0043 and host factors, researchers should employ a multi-faceted approach:

  • Far-Western blotting: Probe recombinant HI_0043 with host proteins to identify direct interactions

  • Surface plasmon resonance (SPR): Quantitatively measure binding kinetics between HI_0043 and candidate host factors

  • ELISA-based binding assays: Screen for interactions with various host components

  • Cell binding assays: Test whether purified HI_0043 binds to specific host cell types

  • Immunoprecipitation from infected cell lysates: Identify host proteins that co-precipitate with HI_0043

When investigating potential immune evasion functions, researchers should specifically test whether HI_0043 interacts with complement components or regulators. Unlike the factor H-binding protein (PH) identified in Haemophilus influenzae , HI_0043 may interact with different components of the host immune system, potentially contributing to bacterial pathogenesis through alternative mechanisms.

How can HI_0043 research contribute to understanding Haemophilus influenzae pathogenesis?

Research on HI_0043 can contribute significantly to understanding H. influenzae pathogenesis through several avenues:

  • Comparative studies with clinical isolates: Examining HI_0043 sequence variation, expression levels, and potential correlation with virulence

  • In vivo infection models: Testing HI_0043 deletion mutants in animal models to assess contribution to colonization and infection

  • Immune response studies: Determining whether HI_0043 elicits specific immune responses during infection

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to place HI_0043 in relevant biological pathways

Understanding the function of HI_0043 could reveal novel aspects of H. influenzae pathogenesis, potentially identifying new mechanisms of bacterial survival in the host. This knowledge may complement existing findings about other virulence factors like the factor H-binding protein (PH), which contributes to resistance against complement activation and consequently promotes bacterial pathogenesis .

What experimental design considerations are critical for advanced studies of HI_0043?

Advanced studies of HI_0043 require careful experimental design to ensure valid and reproducible results. Critical considerations include:

  • Appropriate controls: Include positive and negative controls for all assays, particularly when testing functional hypotheses

  • Variable manipulation: Systematically manipulate one independent variable at a time while controlling for confounding factors

  • Sample size determination: Conduct power analyses to determine appropriate sample sizes for statistical validity

  • Between-subjects vs. within-subjects design: Choose the appropriate experimental design based on your research question

  • Measurement precision: Develop reliable methods to measure dependent variables with high precision and accuracy

How can researchers overcome solubility issues with recombinant HI_0043?

Membrane proteins like HI_0043 often present solubility challenges during recombinant expression and purification. The following methodological approaches can address these issues:

  • Optimization of detergent selection: Systematically screen different detergents (non-ionic, zwitterionic, and mild ionic) at various concentrations

  • Fusion partner strategy: Express HI_0043 with solubility-enhancing fusion partners such as MBP, NusA, or TrxA

  • Buffer optimization: Test different pH values, salt concentrations, and additives (glycerol, specific lipids) to improve stability in solution

  • Truncation constructs: Design and test truncated versions of HI_0043 to identify soluble domains

  • Co-expression with chaperones: Express HI_0043 alongside molecular chaperones to assist proper folding

For particularly challenging constructs, consider alternative solubilization approaches such as amphipols or nanodiscs, which can provide a more native-like environment for membrane proteins compared to detergent micelles.

What strategies can improve the yield and purity of HI_0043 from different expression systems?

To optimize yield and purity of recombinant HI_0043, researchers should consider system-specific strategies:

For E. coli expression:

  • Codon optimization for E. coli usage

  • Testing different E. coli strains (BL21(DE3), Rosetta-GAMI, etc.)

  • Optimizing induction conditions (temperature, IPTG concentration, induction time)

  • Using auto-induction media for controlled expression

  • Implementing directed evolution of the expression strain

For yeast expression:

  • Selection of appropriate strain (SMD1168, GS115, X-33)

  • Optimization of media composition and induction timing

  • Testing different secretion signal sequences

  • Monitoring for hyperglycosylation and implementing strategies to control it

For insect and mammalian cell expression:

  • Selection of appropriate cell lines (Sf9, Sf21, High Five for insect; 293T, CHO for mammalian)

  • Optimization of transfection/infection protocols

  • Selection of appropriate promoters and enhancers

  • Implementation of stable cell line development for long-term production

Regardless of the expression system, implementing a systematic optimization approach with careful documentation of conditions tested and results obtained will facilitate the development of an efficient production process for HI_0043.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.