Recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiEE_04225 (CGSHiEE_04225)

Shipped with Ice Packs
In Stock

Description

Introduction to CGSHiEE_04225

The recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiEE_04225 (UniProt ID: A5UBU9) is a bioengineered version of a bacterial membrane-associated protein belonging to the UPF0299 family. UPF (Uncharacterized Protein Family) designates proteins with unverified functions, though structural and biochemical analyses suggest roles in membrane integrity or host-pathogen interactions. This protein is recombinantly expressed and purified for research and diagnostic applications, particularly in vaccine development and immune response studies .

Primary Sequence and Expression

  • Amino Acid Sequence: The protein spans residues 1–143 (AA sequence: MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRKRKSGKTSQLVC) .

  • Source: Expressed in E. coli, Saccharomyces cerevisiae, baculovirus, or mammalian systems .

  • Tag: Fused with an N-terminal His tag for purification .

Recombinant Production

  • Expression Systems:

    • E. coli: High-yield production with His-tag affinity chromatography .

    • Yeast/Baculovirus/Mammalian: Alternative systems for post-translational modifications (e.g., glycosylation) .

  • Reconstitution: Lyophilized powder dissolved in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Research and Diagnostic Use

  • ELISA Kits: Used to detect anti-CGSHiEE_04225 antibodies in serum/plasma, aiding in immune response profiling .

  • Vaccine Development: Potential antigen candidate for H. influenzae non-typeable (NTHi) vaccines, though efficacy remains unvalidated .

Comparative Analysis with Related UPF0299 Proteins

FeatureCGSHiEE_04225 (A5UBU9)CGSHiGG_01475 (A5UF21)
Length143 aa140 aa
SourceH. influenzae PittEE strainH. influenzae strain
TagHis-tag (N-terminal)His-tag (N-terminal)
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
Expression SystemE. coli/yeast/baculovirusE. coli
Key ApplicationELISA, vaccine researchVaccine antigen research

Data compiled from .

Critical Gaps and Future Directions

  • Functional Characterization: No studies confirm CGSHiEE_04225’s role in pathogenesis or membrane function.

  • Structural Studies: Crystallization or cryo-EM data are needed to elucidate interactions with host factors.

  • Epidemiological Relevance: Assessing its prevalence in clinical isolates (e.g., NTHi vs. encapsulated strains) is essential .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CGSHiEE_04225; UPF0299 membrane protein CGSHiEE_04225
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Haemophilus influenzae (strain PittEE)
Target Names
CGSHiEE_04225
Target Protein Sequence
MIQKLFLLVRSLVILSIMLSLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRKRKSGKTSQLVC
Uniprot No.

Target Background

Database Links
Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.