Recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiGG_01475 (CGSHiGG_01475)

What is the structural characterization of Haemophilus influenzae UPF0299 membrane protein CGSHiGG_01475?

The Haemophilus influenzae UPF0299 membrane protein CGSHiGG_01475 is a full-length (140 amino acids) membrane protein belonging to the UPF0299 protein family. The protein has a UniProt ID of A5UF21 and exhibits characteristics typical of integral membrane proteins. The complete amino acid sequence is: MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLGASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQSFTHKRKKVIKRRENQVKQAN . Analysis of its primary structure using hydrophobicity plotting suggests it contains multiple transmembrane domains with hydrophobic regions that span the lipid bilayer. Secondary structure prediction indicates a predominance of alpha-helical structures, which is consistent with its role as a membrane protein. For structural studies, the recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and detection.

What expression systems are recommended for producing recombinant CGSHiGG_01475?

When using E. coli, optimization of strain selection (e.g., C41(DE3) or C43(DE3) for membrane proteins), induction conditions, and temperature are crucial for obtaining properly folded protein. For membrane proteins like CGSHiGG_01475, expression levels should be carefully controlled to prevent toxicity and aggregation .

What are the optimal storage and reconstitution conditions for recombinant CGSHiGG_01475?

Recombinant CGSHiGG_01475 is typically supplied as a lyophilized powder and requires specific handling for optimal stability and activity. The protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles which can compromise protein integrity . For reconstitution, the following protocol is recommended:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom.

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage.

• Store working aliquots at 4°C for up to one week, and unused portions at -20°C/-80°C .

The buffer composition for storage is typically Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain protein stability. For membrane proteins like CGSHiGG_01475, researchers may need to consider detergent selection for solubilization experiments, with mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) often providing a good balance between protein extraction efficiency and preservation of native structure.

How can researchers determine the membrane topology of CGSHiGG_01475?

Determining the membrane topology of CGSHiGG_01475 requires multiple complementary experimental approaches. The following methodological workflow is recommended:

• Computational prediction: Begin with in silico analysis using algorithms such as TMHMM, HMMTOP, or Phobius to predict transmembrane domains. For CGSHiGG_01475, hydrophobicity analysis suggests multiple transmembrane segments.

• Cysteine scanning mutagenesis: Systematically replace amino acids with cysteine residues and use membrane-impermeable thiol-reactive reagents to determine which regions are accessible from which side of the membrane.

• Protease protection assays: Express the protein in membrane vesicles and treat with proteases. Protected fragments indicate regions embedded in the membrane or facing the vesicle lumen.

• Fluorescence techniques: Employ techniques such as FRET (Förster Resonance Energy Transfer) using fluorescently labeled antibodies against different protein domains to determine their relative positions.

• Epitope insertion and immunodetection: Insert epitope tags at various positions and use antibodies to determine their accessibility in intact cells versus permeabilized cells.

The results from these complementary approaches should be integrated to build a comprehensive model of CGSHiGG_01475's membrane topology. For UPF0299 family proteins, it's particularly important to determine whether the N and C termini are located on the same or opposite sides of the membrane, as this information can provide insights into potential functional mechanisms .

What strategies can overcome expression challenges for CGSHiGG_01475?

Expression of membrane proteins like CGSHiGG_01475 presents specific challenges including toxicity, improper folding, and low yield. The following strategic approaches can help overcome these issues:

For CGSHiGG_01475 specifically, expression in C41(DE3) E. coli with induction at low temperature (18°C) and moderate inducer concentration has shown promising results. The addition of glycerol (0.5-1%) to the growth medium can also help stabilize membrane proteins during expression . Regular monitoring of expression using Western blot analysis at different time points post-induction is recommended to determine the optimal harvest time.

What functional characterization assays are appropriate for CGSHiGG_01475?

Since CGSHiGG_01475 belongs to the UPF0299 family of proteins with uncharacterized function, a systematic approach to functional characterization is essential. The following assays are recommended:

• Lipid binding assays: Use fluorescently labeled lipids or liposome flotation assays to determine if CGSHiGG_01475 interacts preferentially with specific membrane lipids.

• Ion transport measurements: Reconstitute purified CGSHiGG_01475 into liposomes with encapsulated fluorescent ion indicators to test for ion transport activity using stopped-flow fluorescence spectroscopy.

• Protein-protein interaction studies:

  • Pull-down assays using His-tagged CGSHiGG_01475 as bait

  • Bacterial two-hybrid system for in vivo interaction screening

  • Surface plasmon resonance (SPR) for quantitative binding analysis

  • Co-immunoprecipitation from H. influenzae cell lysates

• Genomic context analysis: Examine genes located near CGSHiGG_01475 in the H. influenzae genome for functional hints through guilt-by-association.

• Growth phenotype analysis: Create knockout mutants in H. influenzae and examine growth under various stress conditions (pH, temperature, osmotic shock, nutrient limitation).

• Structural studies: Use circular dichroism (CD) spectroscopy to analyze secondary structure composition in different detergent or lipid environments.

Results should be compared across multiple experimental approaches and validated in vivo where possible. Because UPF0299 proteins remain poorly characterized, researchers should consider broad screening approaches that might reveal unexpected functions.

How can researchers perform comparative analysis between CGSHiGG_01475 and homologous proteins?

To understand the evolutionary context and potential functional conservation of CGSHiGG_01475, comparative analysis with homologous proteins is essential. The following methodological approach is recommended:

• Homology identification:

  • Perform BLAST searches against protein databases to identify homologs

  • Use tools like HMMER to detect more distant relationships based on Hidden Markov Models

  • Construct phylogenetic trees to visualize evolutionary relationships

• Sequence conservation analysis:

  • Perform multiple sequence alignment of identified homologs using MUSCLE or CLUSTAL

  • Identify conserved motifs and residues using sequence logos

  • Map conservation onto predicted structural models

• Structural comparison:

  • Generate homology models using tools like Swiss-Model or AlphaFold

  • Superimpose models with experimentally determined structures of related proteins

  • Identify structurally conserved regions that might indicate functional sites

• Genomic context comparison:

  • Analyze the genomic neighborhood of CGSHiGG_01475 homologs across bacterial species

  • Look for conserved gene clusters that might indicate functional relationships

• Experimental validation:

  • Test functional complementation of CGSHiGG_01475 mutants with homologs from other species

  • Compare biochemical properties of recombinant homologs under identical conditions

Preliminary analysis indicates that CGSHiGG_01475 shares structural features with other UPF0299 family membrane proteins, suggesting potential functional conservation across bacterial species. Special attention should be paid to conserved charged residues within transmembrane domains, as these often play crucial roles in membrane protein function .

What are the optimal purification strategies for obtaining high-purity CGSHiGG_01475?

Purification of membrane proteins like CGSHiGG_01475 requires specialized approaches to maintain protein stability and function. The following purification strategy is recommended:

• Membrane preparation:

  • Harvest E. coli cells expressing CGSHiGG_01475 by centrifugation

  • Resuspend in lysis buffer containing protease inhibitors

  • Disrupt cells by sonication or French press

  • Remove unbroken cells and debris by low-speed centrifugation

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour)

• Solubilization:

  • Solubilize membrane fraction in buffer containing an appropriate detergent

  • For CGSHiGG_01475, a screening of detergents is recommended:

• Affinity chromatography:

  • Apply solubilized protein to Ni-NTA resin

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with high imidazole (250-500 mM)

• Size exclusion chromatography:

  • Apply affinity-purified protein to a Superdex 200 column

  • Collect monodisperse peak fractions

  • Analyze by SDS-PAGE for purity

• Quality control:

  • Verify purity by SDS-PAGE (>90% purity is desirable)

  • Confirm protein identity by Western blot or mass spectrometry

  • Assess protein stability by thermal shift assay

For structural biology applications, consider detergent exchange or reconstitution into lipid nanodiscs or amphipols during the final purification steps. Given the challenges in membrane protein purification, expected yields for CGSHiGG_01475 are typically in the range of 0.5-2 mg per liter of bacterial culture .

How can researchers assess the structural integrity of purified CGSHiGG_01475?

Assessing the structural integrity of purified CGSHiGG_01475 is crucial for ensuring that functional and structural studies are performed with properly folded protein. The following complementary techniques are recommended:

• Thermal stability assessment:

  • Differential scanning fluorimetry (DSF) using SYPRO Orange dye

  • Circular dichroism (CD) spectroscopy with temperature ramping

  • Intrinsic tryptophan fluorescence with temperature gradient

• Secondary structure analysis:

  • Far-UV circular dichroism (190-260 nm) to estimate secondary structure content

  • Expected results for CGSHiGG_01475: high alpha-helical content characteristic of membrane proteins

• Homogeneity assessment:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Analytical ultracentrifugation (AUC) to determine oligomeric state

  • Negative stain electron microscopy for visual inspection

• Detergent binding analysis:

  • Measurement of bound detergent using colorimetric assays

  • Assessment of detergent/protein ratio by SEC-MALS

• Functional folding indicators:

  • Binding assays with known ligands or antibodies that recognize conformational epitopes

  • Limited proteolysis to identify folded domains resistant to digestion

For CGSHiGG_01475, which has multiple predicted transmembrane helices, CD spectroscopy should show a characteristic alpha-helical pattern with minima at 208 and 222 nm. Properly folded protein should also exhibit a monodisperse peak on size exclusion chromatography, with minimal aggregation. Thermal stability assays typically show a cooperative unfolding transition, with the melting temperature (Tm) dependent on the lipid/detergent environment .

What crystallization approaches are suitable for structural determination of CGSHiGG_01475?

Determining the high-resolution structure of membrane proteins like CGSHiGG_01475 presents unique challenges. The following methodological approaches are recommended:

• Conventional vapor diffusion crystallization:

  • Perform extensive screening of detergents prior to crystallization

  • Use sparse matrix screens specifically designed for membrane proteins

  • Optimize protein concentration (typically 5-15 mg/mL)

  • Try both hanging drop and sitting drop methods

  • Consider bicelle or lipidic cubic phase (LCP) crystallization

• Lipidic cubic phase (LCP) crystallization:

  • Mix purified CGSHiGG_01475 with monoolein at 2:3 protein:lipid ratio

  • Dispense as 100-200 nL boluses overlaid with 1 μL precipitant

  • Incubate at 20°C in the dark

  • This method is particularly successful for helical membrane proteins

• Crystallization optimization strategies:

  • Vary detergent type and concentration

  • Screen different lipid additives (cholesterol, specific phospholipids)

  • Test various precipitants (PEGs of different molecular weights)

  • Add specific ligands or antibody fragments to stabilize conformations

• Alternative approaches if crystallization fails:

  • Cryo-electron microscopy (cryo-EM) for proteins >100 kDa or larger complexes

  • Nuclear magnetic resonance (NMR) for specific domains or fragments

  • X-ray free electron laser (XFEL) diffraction for microcrystals

Given that membrane proteins from the UPF0299 family have limited structural information available, researchers should be prepared for extensive screening efforts. Success often depends on identifying conditions that maintain the native fold while promoting ordered crystal packing. Initial diffraction quality may be limited (3-4 Å resolution), but this can still provide valuable structural insights .

How can researchers design experiments to elucidate the physiological role of CGSHiGG_01475 in Haemophilus influenzae?

To determine the physiological role of CGSHiGG_01475 in Haemophilus influenzae, a multi-faceted experimental approach is recommended:

• Gene knockout and complementation:

  • Generate a clean deletion mutant of CGSHiGG_01475 using allelic exchange

  • Create complementation strains expressing wild-type protein from a plasmid

  • Generate point mutations in conserved residues to identify functional sites

  • Assess growth phenotypes under various conditions (temperature, pH, osmotic stress)

• Transcriptomic analysis:

  • Compare gene expression profiles between wild-type and ΔCGSHiGG_01475 strains

  • Identify conditions that induce CGSHiGG_01475 expression

  • Map gene expression changes to specific metabolic or stress response pathways

• Interaction proteomics:

  • Perform co-immunoprecipitation with tagged CGSHiGG_01475

  • Use crosslinking mass spectrometry to identify neighboring proteins

  • Apply proximity labeling methods (BioID, APEX) to identify nearby proteins in vivo

• Membrane physiology assays:

  • Measure membrane potential using fluorescent dyes

  • Assess membrane permeability to various compounds

  • Measure intracellular pH regulation ability

  • Test sensitivity to membrane-targeting antibiotics

• Infection models:

  • Compare colonization ability of wild-type and mutant strains

  • Assess survival under host immune system pressure

  • Measure biofilm formation capability

Since UPF0299 family proteins are poorly characterized, it's advisable to cast a wide net of experiments. Initial phenotypic screenings should include growth in different media compositions, resistance to various stresses (oxidative, pH, temperature), and membrane integrity assays. The results from these screenings will guide more focused studies into specific physiological roles .

What are the recommended protein-lipid interaction studies for CGSHiGG_01475?

As a membrane protein, CGSHiGG_01475's function is likely influenced by its lipid environment. The following methodological approaches are recommended for investigating protein-lipid interactions:

• Thin layer chromatography (TLC) binding assays:

  • Spot various lipids on TLC plates

  • Overlay with purified CGSHiGG_01475

  • Detect bound protein using antibodies against the His-tag

  • This provides a rapid screen for specific lipid binding

• Liposome flotation assays:

  • Prepare liposomes with different lipid compositions

  • Incubate with CGSHiGG_01475

  • Separate by density gradient centrifugation

  • Analyze protein distribution between bound and unbound fractions

• Microscale thermophoresis (MST):

  • Label CGSHiGG_01475 with fluorescent dye

  • Titrate with specific lipids in detergent micelles

  • Measure changes in thermophoretic mobility

  • Calculate binding affinities for different lipids

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Compare deuterium uptake of CGSHiGG_01475 in different lipid environments

  • Identify regions with altered solvent accessibility

  • Map potential lipid interaction sites

• Molecular dynamics simulations:

  • Build computational models of CGSHiGG_01475 in membranes

  • Simulate protein behavior in different lipid compositions

  • Identify stable lipid-protein interactions

For CGSHiGG_01475, special attention should be paid to interactions with bacterial membrane components like phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin. Additionally, examining interactions with host-derived lipids might provide insights into potential roles during infection. The stability and activity of membrane proteins often depend on specific lipid interactions, so identifying these relationships is crucial for understanding CGSHiGG_01475's function .

What are the current knowledge gaps and future research priorities for CGSHiGG_01475?

Despite the availability of recombinant CGSHiGG_01475 for research purposes, significant knowledge gaps remain regarding this protein's structure, function, and biological significance. Key areas for future investigation include:

• High-resolution structural determination:

  • Solve the three-dimensional structure using X-ray crystallography, cryo-EM, or NMR

  • Map the membrane topology and identify potential functional sites

  • Compare structural features with other UPF0299 family members

• Functional characterization:

  • Determine if CGSHiGG_01475 functions as a transporter, channel, or structural protein

  • Identify potential substrates or binding partners

  • Establish the role in H. influenzae physiology and pathogenesis

• Regulation studies:

  • Characterize the transcriptional regulation of CGSHiGG_01475

  • Identify environmental conditions that modulate expression

  • Determine post-translational modifications and their impact

• Evolutionary conservation:

  • Conduct comparative genomics across bacterial species

  • Assess functional conservation through complementation studies

  • Identify selective pressures acting on UPF0299 family proteins

• Therapeutic targeting potential:

  • Evaluate CGSHiGG_01475 as a potential drug target

  • Develop high-throughput screening assays for inhibitor discovery

  • Assess effects of CGSHiGG_01475 inhibition on bacterial viability

These research priorities should be addressed using a combination of biochemical, structural, genetic, and computational approaches. The unknown function of UPF0299 family proteins presents both a challenge and an opportunity for discovery of novel bacterial physiological mechanisms that may contribute to pathogenesis or survival .

How can researchers troubleshoot common experimental challenges with CGSHiGG_01475?

Working with membrane proteins like CGSHiGG_01475 presents unique technical challenges. The following troubleshooting strategies address common issues:

For structural biology applications, special attention should be paid to protein monodispersity, as assessed by size exclusion chromatography profiles. The addition of specific lipids during purification and storage can often improve stability and homogeneity of membrane proteins like CGSHiGG_01475. Additionally, screening different detergents at various stages (extraction, purification, crystallization) is often key to success in membrane protein research .