Recombinant Haemophilus influenzae UPF0299 membrane protein HI_1297 (HI_1297)

Shipped with Ice Packs
In Stock

Description

Protein Overview

HI_1297 is a hypothetical membrane protein encoded by the HI_1297 gene in H. influenzae strain ATCC 51907 (Rd KW20). It belongs to the UPF0299 family, which includes uncharacterized membrane proteins conserved across bacterial species . The recombinant version is produced in E. coli with an N-terminal His tag for purification .

Amino Acid Sequence

The full-length sequence (1-140aa) is:
MIKKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN

Features:

  • Predicted multi-pass transmembrane domains (by HAMAP-Rule MF_01144) .

  • No enzymatic or ligand-binding domains identified to date.

Expression System

  • Host: E. coli

  • Vector: Proprietary plasmid optimized for high-yield expression.

Purification Methodology

  1. Affinity Chromatography: Nickel-NTA resin for His-tag binding .

  2. Buffer Composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

  3. Final Form: Lyophilized powder for enhanced stability .

Yield and Stability

  • Storage: -20°C/-80°C long-term; 4°C for working aliquots (≤1 week) .

  • Reconstitution: Sterile water with optional glycerol (5–50%) to prevent aggregation .

Biochemical Properties

PropertyDetails
SolubilityRequires detergents for membrane protein solubilization (not specified in sources).
StabilitySensitive to repeated freeze-thaw cycles; glycerol improves longevity .
InteractionsNo experimentally confirmed interactors reported .

Research Applications

  • SDS-PAGE Analysis: Primary application cited by suppliers .

  • Antibody Production: Potential use for generating anti-H. influenzae antibodies.

  • Structural Studies: Basis for membrane protein crystallization trials.

Research Significance

While HI_1297’s exact biological role remains uncharacterized, its study is critical for:

  1. Antibiotic Resistance: H. influenzae exhibits rising multi-drug resistance (MDR), necessitating novel drug targets .

  2. Pathogen Evolution: Comparative genomics of global H. influenzae strains highlights conserved hypothetical proteins like HI_1297 as potential virulence or fitness factors .

  3. Vaccine Development: Membrane proteins are often explored as vaccine candidates against bacterial pathogens.

Limitations and Future Directions

  • Functional Data Gap: No experimental evidence for HI_1297’s role in metabolism or pathogenesis .

  • Structural Insights: Cryo-EM or X-ray crystallography needed to resolve 3D architecture.

  • Interaction Mapping: Yeast two-hybrid or co-IP studies could identify binding partners .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
HI_1297; UPF0299 membrane protein HI_1297
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_1297
Target Protein Sequence
MIKKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN
Uniprot No.

Target Background

Database Links

KEGG: hin:HI1297

STRING: 71421.HI1297

Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant HI_1297 production?

E. coli is the validated expression system for recombinant HI_1297 protein production. The protein is typically expressed with an N-terminal His-tag to facilitate purification. When designing expression constructs, consider the following methodological approaches:

  • Use bacterial expression vectors with strong, inducible promoters (T7, tac)

  • Optimize codon usage for E. coli if necessary

  • Consider specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)

  • Test different induction conditions (temperature, inducer concentration, duration)

  • Evaluate detergent screening for optimal extraction from membranes

Expression in E. coli provides high yields, though researchers should monitor for potential inclusion body formation, which would require refolding protocols. Alternative eukaryotic expression systems might be considered if functional studies require post-translational modifications not present in bacterial systems .

What purification strategy should be employed for HI_1297?

The established purification approach for His-tagged HI_1297 involves:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using appropriate detergents (e.g., DDM, LDAO)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for increased purity if needed

The purified protein can be obtained at >90% purity as determined by SDS-PAGE. Researchers should note that repeated freeze-thaw cycles should be avoided during purification and subsequent storage. For experimental work requiring higher purity, consider additional chromatography steps such as ion exchange to remove co-purifying contaminants .

What are the optimal storage conditions for purified HI_1297?

For maximum stability and activity retention, store purified HI_1297 according to these guidelines:

  • Store as aliquots at -20°C/-80°C for long-term storage

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as storage buffer

  • Add glycerol to 5-50% final concentration before freezing (50% is standard)

  • Store working aliquots at 4°C for up to one week

  • Prior to use, briefly centrifuge vials to bring contents to bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

The addition of trehalose and glycerol serves as cryoprotectants to maintain protein integrity during freeze-thaw cycles. For experiments requiring membrane-embedded protein, reconstitution into liposomes or nanodiscs should be performed immediately before use rather than storing the protein in these forms .

How can the membrane insertion mechanism of HI_1297 be studied?

To investigate the membrane insertion mechanism of HI_1297, researchers can leverage approaches based on EMC (ER Membrane protein Complex) studies:

  • Site-specific photocrosslinking analysis:

    • Incorporate photoreactive amino acids (e.g., benzoyl-phenylalanine) at strategic positions

    • Identify interaction partners during membrane insertion

    • Map the trajectory of insertion using crosslinked products

  • In vitro reconstitution assays:

    • Create liposomes with defined lipid compositions

    • Monitor insertion efficiency using protease protection assays

    • Employ fluorescence-based assays to track insertion kinetics

  • Cryo-EM structural analysis:

    • Examine if HI_1297 utilizes a membrane protein insertion machinery

    • Compare with known insertion pathways for small membrane proteins

    • Identify potential cytosolic vestibules or intramembrane grooves involved in insertion

Studies of EMC architecture reveal that membrane proteins with simple topologies may utilize specialized insertion pathways involving hydrophobic vestibules that guide transmembrane domains into the lipid bilayer. This could be applicable to HI_1297 insertion as well .

What methods can be used to study HI_1297 stability and folding?

For quantitative analysis of HI_1297 stability and folding kinetics, consider employing the steric trap method as follows:

  • Engineering the construct:

    • Modify the wild-type HI_1297 with two accessible biotin tags at strategic positions

    • Incorporate helix-terminal pyrene labels to monitor inter-helical contacts via fluorescence

    • Verify construct integrity using circular dichroism spectroscopy

  • Unfolding experiments:

    • Add monovalent streptavidin (mSA) to induce unfolding

    • Monitor loss of inter-helical contacts via decreases in pyrene excimer fluorescence

    • Validate unfolding using SDS-PAGE to visualize mSA-bound species

  • Data analysis:

    • Determine thermodynamic parameters of folding

    • Calculate ΔG values for membrane protein stability

    • Compare wild-type with mutant variants to assess effects on stability

This approach allows for quantitative measurement of membrane protein stability while maintaining the integrity of the membrane environment, making it particularly valuable for examining how disease-associated mutations might affect protein stability .

How can structure-function relationships in HI_1297 be experimentally determined?

To elucidate structure-function relationships in HI_1297, implement a systematic approach combining computational and experimental methods:

  • Computational analysis:

    • Perform sequence-based predictions of transmembrane domains

    • Use ab initio modeling approaches similar to trRosetta for structural prediction

    • Identify conserved residues through multiple sequence alignment

  • Mutagenesis strategy:

    • Design a comprehensive alanine scanning mutagenesis library

    • Focus on highly conserved residues and predicted functional domains

    • Create charge-reversal mutations in potential interaction sites

  • Functional assays:

    • Develop reporter systems to assess protein functionality

    • Measure membrane integration efficiency of mutant proteins

    • Monitor protein-protein interactions using in vitro and in vivo techniques

  • Structural validation:

    • Employ NMR spectroscopy for structural determination in membrane mimetics

    • Use hydrogen-deuterium exchange mass spectrometry to map exposed regions

    • Consider solid-state NMR for membrane-embedded structural analysis

These techniques will help establish correlations between specific amino acid residues, structural elements, and functional properties of the HI_1297 protein .

What is the role of lipid composition in HI_1297 function and how can it be investigated?

The lipid environment can significantly impact membrane protein function. To investigate lipid-protein interactions for HI_1297:

  • Reconstitution experiments:

    • Prepare proteoliposomes with systematically varied lipid compositions

    • Test different headgroups, acyl chain lengths, and degrees of saturation

    • Include native H. influenzae lipid extracts as a physiologically relevant condition

  • Biophysical measurements:

    • Use fluorescence anisotropy to monitor protein mobility in different lipid environments

    • Employ differential scanning calorimetry to assess thermal stability

    • Implement EPR spectroscopy with spin-labeled proteins to track conformational changes

  • Molecular dynamics simulations:

    • Model protein-lipid interactions in silico

    • Predict preferential interactions with specific lipid types

    • Identify potential lipid binding sites on the protein surface

  • Lipid-protein crosslinking:

    • Use photoactivatable lipid analogs to identify specific lipid binding sites

    • Map the lipid interaction surface using mass spectrometry

    • Correlate with predicted transmembrane domain boundaries

This multi-faceted approach will reveal how the membrane environment modulates HI_1297 structure and potentially its biological function in Haemophilus influenzae .

How can researchers investigate potential protein-protein interactions involving HI_1297?

To characterize the interactome of HI_1297 and identify functional partners:

  • In vivo crosslinking approaches:

    • Perform chemical crosslinking in native Haemophilus influenzae

    • Use site-specific photocrosslinking with unnatural amino acids

    • Identify crosslinked partners via mass spectrometry

  • Co-immunoprecipitation strategies:

    • Express tagged versions of HI_1297 in H. influenzae

    • Optimize detergent conditions to maintain native interactions

    • Identify co-precipitating proteins using proteomics

  • Proximity labeling methods:

    • Fuse HI_1297 with enzymes like BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Identify labeled proteins using streptavidin pulldown and mass spectrometry

  • Bacterial two-hybrid screening:

    • Create fusion constructs with split reporter domains

    • Screen against H. influenzae genomic library

    • Validate positive interactions using orthogonal methods

These techniques will help establish whether HI_1297 functions independently or as part of larger protein complexes, potentially providing insights into its biological role .

What controls should be included when studying recombinant HI_1297?

A robust experimental design for HI_1297 studies should incorporate the following controls:

Control TypePurposeImplementation
Positive ControlsVerify assay functionalityInclude well-characterized membrane proteins of similar size
Negative ControlsEstablish background signalUse buffer-only or irrelevant protein samples
Expression ControlsMonitor expression levelsWestern blot with anti-His antibodies
Folding ControlsConfirm proper foldingCD spectroscopy to verify secondary structure
Activity ControlsValidate functional assaysInclude known functional variants if available
Stability ControlsAssess sample integrityTime-course analysis of protein stability
Localization ControlsVerify membrane integrationMembrane fractionation and protease protection assays

Additionally, include wild-type versus mutant comparisons and time-dependent measurements to ensure reproducibility and reliability of results. For photocrosslinking experiments, non-UV exposed samples provide essential negative controls .

How can researchers troubleshoot poor expression or purification yields of HI_1297?

When encountering challenges with HI_1297 expression or purification, implement this systematic troubleshooting approach:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Vary induction conditions (temperature: 16°C, 25°C, 37°C)

    • Adjust inducer concentration (0.1-1.0 mM IPTG)

    • Extend expression time (4h vs. overnight)

    • Add membrane protein expression enhancers (e.g., DMSO, glycerol)

  • Solubilization optimization:

    • Screen detergent panel (DDM, LDAO, OG, CHAPS)

    • Test detergent concentrations (1-5x CMC)

    • Include stabilizing additives (glycerol, specific lipids)

    • Optimize pH and ionic strength conditions

    • Consider mild solubilization (longer time, lower temperature)

  • Purification refinement:

    • Adjust imidazole concentrations in binding/washing steps

    • Test different metal ions for IMAC (Ni2+, Co2+)

    • Implement on-column detergent exchange

    • Include protease inhibitors throughout purification

    • Consider alternative purification tags (Strep-tag, FLAG)

If inclusion bodies form, develop a refolding protocol using a gradual dialysis approach with decreasing denaturant concentrations and appropriate detergents or lipids to facilitate proper refolding .

What analytical methods are most appropriate for verifying the structural integrity of purified HI_1297?

To verify structural integrity and functional state of purified HI_1297, employ these complementary analytical techniques:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy: Confirm α-helical secondary structure

    • Dynamic light scattering (DLS): Assess monodispersity and aggregation state

    • Tryptophan fluorescence: Monitor tertiary structural integrity

    • Differential scanning calorimetry: Determine thermal stability

  • Biochemical assessment:

    • Size-exclusion chromatography: Verify oligomeric state

    • SDS-PAGE: Confirm size and purity (>90%)

    • Blue-native PAGE: Analyze native oligomeric assemblies

    • Limited proteolysis: Probe for properly folded conformations

  • Structural techniques:

    • Negative-stain electron microscopy: Visualize protein-detergent complexes

    • FTIR spectroscopy: Estimate secondary structure content in membranes

    • HDX-MS: Map solvent-accessible regions

    • EPR spectroscopy: Analyze protein dynamics in membrane mimetics

These analytical approaches provide complementary structural information to ensure that purified HI_1297 maintains its native conformation and is suitable for downstream functional and structural studies .

How can HI_1297 be used as a model system for membrane protein insertion studies?

HI_1297 can serve as an excellent model system for fundamental membrane protein insertion studies due to its relatively small size (140 amino acids) and multiple transmembrane domains:

  • Comparative insertion pathway analysis:

    • Investigate co-translational vs. post-translational insertion routes

    • Compare insertion via Sec61 translocon versus EMC pathway

    • Determine if insertion requires additional chaperones or insertases

  • Minimal system reconstitution:

    • Define the minimal protein machinery required for insertion

    • Establish purified component systems for mechanistic studies

    • Compare with other small membrane proteins to define general principles

  • Real-time insertion monitoring:

    • Develop fluorescence-based assays to track insertion kinetics

    • Implement single-molecule approaches to observe insertion events

    • Use crosslinking to capture insertion intermediates

  • Structure-function relationships:

    • Create chimeric proteins to identify insertion determinants

    • Systematically alter hydrophobicity profiles of transmembrane domains

    • Assess the impact of flanking charged residues on insertion efficiency

This research could illuminate general principles of membrane protein biogenesis while also providing specific insights into bacterial membrane protein assembly mechanisms .

What techniques can be applied to determine the high-resolution structure of HI_1297?

For high-resolution structural determination of HI_1297, researchers should consider these methodological approaches:

  • X-ray crystallography strategy:

    • Screen detergents for crystallization (DDM, LDAO, OG, C8E4)

    • Employ lipidic cubic phase crystallization

    • Use antibody fragments or crystallization chaperones to promote crystal contacts

    • Implement surface entropy reduction mutations to enhance crystallizability

  • Cryo-EM approach:

    • Reconstitute in nanodiscs or amphipols to increase particle size

    • Consider fusion proteins to add mass (e.g., BRIL, T4 lysozyme)

    • Implement focused refinement techniques for small membrane proteins

    • Use advanced particle picking algorithms for small proteins

  • NMR spectroscopy methods:

    • Produce isotopically labeled protein (15N, 13C, 2H)

    • Optimize detergent micelles or nanodiscs for solution NMR

    • Consider solid-state NMR in lipid bilayers

    • Implement specific labeling schemes to overcome size limitations

  • Hybrid method integration:

    • Combine low-resolution data with computational modeling

    • Use crosslinking mass spectrometry to obtain distance constraints

    • Implement Rosetta membrane protein modeling with experimental restraints

    • Validate structural models using molecular dynamics simulations

These approaches provide complementary structural information that can be integrated to determine a high-resolution structure of HI_1297 in a membrane-like environment .

How can the functional role of HI_1297 in H. influenzae biology be experimentally determined?

To elucidate the biological function of HI_1297 in Haemophilus influenzae, implement a comprehensive experimental strategy:

  • Genetic manipulation approaches:

    • Generate knockout or depletion strains in H. influenzae

    • Create complementation strains to verify phenotypes

    • Develop conditional expression systems for essential genes

    • Implement CRISPR interference for titratable gene repression

  • Phenotypic characterization:

    • Assess growth under various environmental conditions (pH, temperature, osmolarity)

    • Evaluate resistance to antibiotics and environmental stressors

    • Measure membrane permeability and potential

    • Examine biofilm formation and host cell interactions

  • Omics-based analyses:

    • Perform transcriptomics to identify affected pathways

    • Use proteomics to detect changes in protein expression profiles

    • Implement metabolomics to uncover altered metabolic pathways

    • Conduct lipidomics to examine membrane composition changes

  • Protein localization and dynamics:

    • Generate fluorescent protein fusions to track cellular localization

    • Implement super-resolution microscopy to define subcellular distribution

    • Use FRAP to measure protein mobility in the membrane

    • Employ pulse-chase experiments to determine protein turnover rates

This multifaceted approach will provide insights into the physiological role of HI_1297 and its potential as a therapeutic target in H. influenzae infections .

What are the best approaches for studying potential post-translational modifications of HI_1297?

To comprehensively characterize potential post-translational modifications (PTMs) of HI_1297:

  • Mass spectrometry-based approaches:

    • Implement bottom-up proteomics with multiple proteases

    • Use top-down proteomics for intact protein analysis

    • Apply electron transfer dissociation for labile modification preservation

    • Perform targeted MS/MS for known modification sites

  • Modification-specific enrichment:

    • Employ phosphopeptide enrichment (TiO2, IMAC)

    • Use lectins for glycosylation enrichment

    • Implement antibody-based enrichment for specific modifications

    • Apply chemical labeling strategies for cysteine modifications

  • Site-directed mutagenesis validation:

    • Mutate identified modification sites to non-modifiable residues

    • Create phosphomimetic mutations (S/T→D/E)

    • Develop modification-specific antibodies for validation

    • Assess functional consequences of preventing modifications

  • In vivo dynamics:

    • Monitor modification changes under different growth conditions

    • Examine modification status during infection models

    • Track modifications during membrane insertion and maturation

    • Identify enzymes responsible for adding/removing modifications

This systematic approach will reveal whether HI_1297 undergoes PTMs that might regulate its function, localization, or interactions with other cellular components .

What are the emerging technologies that could advance HI_1297 research?

Several cutting-edge technologies show promise for advancing HI_1297 research:

  • Advanced structural biology approaches:

    • Micro-electron diffraction (MicroED) for small membrane protein crystals

    • Integrative structural biology combining cryo-EM, crosslinking-MS, and modeling

    • Time-resolved structural methods to capture folding intermediates

    • AI-based structure prediction specifically trained on membrane proteins

  • Single-molecule techniques:

    • Optical tweezers for membrane protein folding energetics

    • Single-molecule FRET to track conformational dynamics

    • Nanopore-based analysis of membrane protein insertion

    • High-speed AFM for real-time conformational changes

  • Advanced genetic approaches:

    • Genome-wide CRISPRi screens to identify genetic interactions

    • Deep mutational scanning for comprehensive structure-function mapping

    • In vivo directed evolution to identify functional variants

    • Synthetic biology approaches to reconstitute minimal systems

  • Computational advancements:

    • Enhanced molecular dynamics simulations with improved membrane force fields

    • Machine learning for prediction of membrane protein-protein interactions

    • Systems biology models incorporating membrane protein function

    • Integrative bioinformatics platforms for membrane proteome analysis

These emerging technologies will facilitate more detailed understanding of membrane protein biology generally and HI_1297 specifically, potentially leading to new therapeutic strategies targeting bacterial membrane proteins .

How might findings from HI_1297 research translate to other membrane protein systems?

Knowledge gained from HI_1297 studies can have broad implications for membrane protein research:

  • Methodological advances:

    • Optimized protocols for small membrane protein expression and purification

    • Validated approaches for stability measurement applicable to other systems

    • Improved structural determination methods for multi-pass membrane proteins

    • Enhanced computational tools for membrane protein prediction

  • Biological insights:

    • Better understanding of membrane protein insertion pathways

    • Expanded knowledge of protein-lipid interactions in bacterial membranes

    • Improved models of membrane protein folding and stability

    • New paradigms for membrane protein quality control mechanisms

  • Translational applications:

    • Novel antibacterial strategies targeting membrane protein biogenesis

    • Improved approaches for membrane protein drug target identification

    • Enhanced methods for recombinant membrane protein production

    • New tools for studying disease-associated membrane protein mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.