HI_1297 is a hypothetical membrane protein encoded by the HI_1297 gene in H. influenzae strain ATCC 51907 (Rd KW20). It belongs to the UPF0299 family, which includes uncharacterized membrane proteins conserved across bacterial species . The recombinant version is produced in E. coli with an N-terminal His tag for purification .
The full-length sequence (1-140aa) is:
MIKKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN
Predicted multi-pass transmembrane domains (by HAMAP-Rule MF_01144) .
No enzymatic or ligand-binding domains identified to date.
Affinity Chromatography: Nickel-NTA resin for His-tag binding .
Buffer Composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .
Storage: -20°C/-80°C long-term; 4°C for working aliquots (≤1 week) .
Reconstitution: Sterile water with optional glycerol (5–50%) to prevent aggregation .
Antibody Production: Potential use for generating anti-H. influenzae antibodies.
Structural Studies: Basis for membrane protein crystallization trials.
While HI_1297’s exact biological role remains uncharacterized, its study is critical for:
Antibiotic Resistance: H. influenzae exhibits rising multi-drug resistance (MDR), necessitating novel drug targets .
Pathogen Evolution: Comparative genomics of global H. influenzae strains highlights conserved hypothetical proteins like HI_1297 as potential virulence or fitness factors .
Vaccine Development: Membrane proteins are often explored as vaccine candidates against bacterial pathogens.
KEGG: hin:HI1297
STRING: 71421.HI1297
E. coli is the validated expression system for recombinant HI_1297 protein production. The protein is typically expressed with an N-terminal His-tag to facilitate purification. When designing expression constructs, consider the following methodological approaches:
Use bacterial expression vectors with strong, inducible promoters (T7, tac)
Optimize codon usage for E. coli if necessary
Consider specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)
Test different induction conditions (temperature, inducer concentration, duration)
Evaluate detergent screening for optimal extraction from membranes
Expression in E. coli provides high yields, though researchers should monitor for potential inclusion body formation, which would require refolding protocols. Alternative eukaryotic expression systems might be considered if functional studies require post-translational modifications not present in bacterial systems .
The established purification approach for His-tagged HI_1297 involves:
Cell lysis using mechanical disruption or detergent-based methods
Membrane fraction isolation via differential centrifugation
Solubilization using appropriate detergents (e.g., DDM, LDAO)
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Size exclusion chromatography for increased purity if needed
The purified protein can be obtained at >90% purity as determined by SDS-PAGE. Researchers should note that repeated freeze-thaw cycles should be avoided during purification and subsequent storage. For experimental work requiring higher purity, consider additional chromatography steps such as ion exchange to remove co-purifying contaminants .
For maximum stability and activity retention, store purified HI_1297 according to these guidelines:
Store as aliquots at -20°C/-80°C for long-term storage
Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as storage buffer
Add glycerol to 5-50% final concentration before freezing (50% is standard)
Store working aliquots at 4°C for up to one week
Prior to use, briefly centrifuge vials to bring contents to bottom
Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
The addition of trehalose and glycerol serves as cryoprotectants to maintain protein integrity during freeze-thaw cycles. For experiments requiring membrane-embedded protein, reconstitution into liposomes or nanodiscs should be performed immediately before use rather than storing the protein in these forms .
To investigate the membrane insertion mechanism of HI_1297, researchers can leverage approaches based on EMC (ER Membrane protein Complex) studies:
Site-specific photocrosslinking analysis:
Incorporate photoreactive amino acids (e.g., benzoyl-phenylalanine) at strategic positions
Identify interaction partners during membrane insertion
Map the trajectory of insertion using crosslinked products
In vitro reconstitution assays:
Create liposomes with defined lipid compositions
Monitor insertion efficiency using protease protection assays
Employ fluorescence-based assays to track insertion kinetics
Cryo-EM structural analysis:
Examine if HI_1297 utilizes a membrane protein insertion machinery
Compare with known insertion pathways for small membrane proteins
Identify potential cytosolic vestibules or intramembrane grooves involved in insertion
Studies of EMC architecture reveal that membrane proteins with simple topologies may utilize specialized insertion pathways involving hydrophobic vestibules that guide transmembrane domains into the lipid bilayer. This could be applicable to HI_1297 insertion as well .
For quantitative analysis of HI_1297 stability and folding kinetics, consider employing the steric trap method as follows:
Engineering the construct:
Modify the wild-type HI_1297 with two accessible biotin tags at strategic positions
Incorporate helix-terminal pyrene labels to monitor inter-helical contacts via fluorescence
Verify construct integrity using circular dichroism spectroscopy
Unfolding experiments:
Add monovalent streptavidin (mSA) to induce unfolding
Monitor loss of inter-helical contacts via decreases in pyrene excimer fluorescence
Validate unfolding using SDS-PAGE to visualize mSA-bound species
Data analysis:
Determine thermodynamic parameters of folding
Calculate ΔG values for membrane protein stability
Compare wild-type with mutant variants to assess effects on stability
This approach allows for quantitative measurement of membrane protein stability while maintaining the integrity of the membrane environment, making it particularly valuable for examining how disease-associated mutations might affect protein stability .
To elucidate structure-function relationships in HI_1297, implement a systematic approach combining computational and experimental methods:
Computational analysis:
Perform sequence-based predictions of transmembrane domains
Use ab initio modeling approaches similar to trRosetta for structural prediction
Identify conserved residues through multiple sequence alignment
Mutagenesis strategy:
Design a comprehensive alanine scanning mutagenesis library
Focus on highly conserved residues and predicted functional domains
Create charge-reversal mutations in potential interaction sites
Functional assays:
Develop reporter systems to assess protein functionality
Measure membrane integration efficiency of mutant proteins
Monitor protein-protein interactions using in vitro and in vivo techniques
Structural validation:
Employ NMR spectroscopy for structural determination in membrane mimetics
Use hydrogen-deuterium exchange mass spectrometry to map exposed regions
Consider solid-state NMR for membrane-embedded structural analysis
These techniques will help establish correlations between specific amino acid residues, structural elements, and functional properties of the HI_1297 protein .
The lipid environment can significantly impact membrane protein function. To investigate lipid-protein interactions for HI_1297:
Reconstitution experiments:
Prepare proteoliposomes with systematically varied lipid compositions
Test different headgroups, acyl chain lengths, and degrees of saturation
Include native H. influenzae lipid extracts as a physiologically relevant condition
Biophysical measurements:
Use fluorescence anisotropy to monitor protein mobility in different lipid environments
Employ differential scanning calorimetry to assess thermal stability
Implement EPR spectroscopy with spin-labeled proteins to track conformational changes
Molecular dynamics simulations:
Model protein-lipid interactions in silico
Predict preferential interactions with specific lipid types
Identify potential lipid binding sites on the protein surface
Lipid-protein crosslinking:
Use photoactivatable lipid analogs to identify specific lipid binding sites
Map the lipid interaction surface using mass spectrometry
Correlate with predicted transmembrane domain boundaries
This multi-faceted approach will reveal how the membrane environment modulates HI_1297 structure and potentially its biological function in Haemophilus influenzae .
To characterize the interactome of HI_1297 and identify functional partners:
In vivo crosslinking approaches:
Perform chemical crosslinking in native Haemophilus influenzae
Use site-specific photocrosslinking with unnatural amino acids
Identify crosslinked partners via mass spectrometry
Co-immunoprecipitation strategies:
Express tagged versions of HI_1297 in H. influenzae
Optimize detergent conditions to maintain native interactions
Identify co-precipitating proteins using proteomics
Proximity labeling methods:
Fuse HI_1297 with enzymes like BioID or APEX2
Allow in vivo biotinylation of proximal proteins
Identify labeled proteins using streptavidin pulldown and mass spectrometry
Bacterial two-hybrid screening:
Create fusion constructs with split reporter domains
Screen against H. influenzae genomic library
Validate positive interactions using orthogonal methods
These techniques will help establish whether HI_1297 functions independently or as part of larger protein complexes, potentially providing insights into its biological role .
A robust experimental design for HI_1297 studies should incorporate the following controls:
| Control Type | Purpose | Implementation |
|---|---|---|
| Positive Controls | Verify assay functionality | Include well-characterized membrane proteins of similar size |
| Negative Controls | Establish background signal | Use buffer-only or irrelevant protein samples |
| Expression Controls | Monitor expression levels | Western blot with anti-His antibodies |
| Folding Controls | Confirm proper folding | CD spectroscopy to verify secondary structure |
| Activity Controls | Validate functional assays | Include known functional variants if available |
| Stability Controls | Assess sample integrity | Time-course analysis of protein stability |
| Localization Controls | Verify membrane integration | Membrane fractionation and protease protection assays |
Additionally, include wild-type versus mutant comparisons and time-dependent measurements to ensure reproducibility and reliability of results. For photocrosslinking experiments, non-UV exposed samples provide essential negative controls .
When encountering challenges with HI_1297 expression or purification, implement this systematic troubleshooting approach:
Expression optimization:
Test multiple E. coli strains (BL21, C41/C43, Rosetta)
Vary induction conditions (temperature: 16°C, 25°C, 37°C)
Adjust inducer concentration (0.1-1.0 mM IPTG)
Extend expression time (4h vs. overnight)
Add membrane protein expression enhancers (e.g., DMSO, glycerol)
Solubilization optimization:
Screen detergent panel (DDM, LDAO, OG, CHAPS)
Test detergent concentrations (1-5x CMC)
Include stabilizing additives (glycerol, specific lipids)
Optimize pH and ionic strength conditions
Consider mild solubilization (longer time, lower temperature)
Purification refinement:
Adjust imidazole concentrations in binding/washing steps
Test different metal ions for IMAC (Ni2+, Co2+)
Implement on-column detergent exchange
Include protease inhibitors throughout purification
Consider alternative purification tags (Strep-tag, FLAG)
If inclusion bodies form, develop a refolding protocol using a gradual dialysis approach with decreasing denaturant concentrations and appropriate detergents or lipids to facilitate proper refolding .
To verify structural integrity and functional state of purified HI_1297, employ these complementary analytical techniques:
Biophysical characterization:
Circular dichroism (CD) spectroscopy: Confirm α-helical secondary structure
Dynamic light scattering (DLS): Assess monodispersity and aggregation state
Tryptophan fluorescence: Monitor tertiary structural integrity
Differential scanning calorimetry: Determine thermal stability
Biochemical assessment:
Size-exclusion chromatography: Verify oligomeric state
SDS-PAGE: Confirm size and purity (>90%)
Blue-native PAGE: Analyze native oligomeric assemblies
Limited proteolysis: Probe for properly folded conformations
Structural techniques:
Negative-stain electron microscopy: Visualize protein-detergent complexes
FTIR spectroscopy: Estimate secondary structure content in membranes
HDX-MS: Map solvent-accessible regions
EPR spectroscopy: Analyze protein dynamics in membrane mimetics
These analytical approaches provide complementary structural information to ensure that purified HI_1297 maintains its native conformation and is suitable for downstream functional and structural studies .
HI_1297 can serve as an excellent model system for fundamental membrane protein insertion studies due to its relatively small size (140 amino acids) and multiple transmembrane domains:
Comparative insertion pathway analysis:
Investigate co-translational vs. post-translational insertion routes
Compare insertion via Sec61 translocon versus EMC pathway
Determine if insertion requires additional chaperones or insertases
Minimal system reconstitution:
Define the minimal protein machinery required for insertion
Establish purified component systems for mechanistic studies
Compare with other small membrane proteins to define general principles
Real-time insertion monitoring:
Develop fluorescence-based assays to track insertion kinetics
Implement single-molecule approaches to observe insertion events
Use crosslinking to capture insertion intermediates
Structure-function relationships:
Create chimeric proteins to identify insertion determinants
Systematically alter hydrophobicity profiles of transmembrane domains
Assess the impact of flanking charged residues on insertion efficiency
This research could illuminate general principles of membrane protein biogenesis while also providing specific insights into bacterial membrane protein assembly mechanisms .
For high-resolution structural determination of HI_1297, researchers should consider these methodological approaches:
X-ray crystallography strategy:
Screen detergents for crystallization (DDM, LDAO, OG, C8E4)
Employ lipidic cubic phase crystallization
Use antibody fragments or crystallization chaperones to promote crystal contacts
Implement surface entropy reduction mutations to enhance crystallizability
Cryo-EM approach:
Reconstitute in nanodiscs or amphipols to increase particle size
Consider fusion proteins to add mass (e.g., BRIL, T4 lysozyme)
Implement focused refinement techniques for small membrane proteins
Use advanced particle picking algorithms for small proteins
NMR spectroscopy methods:
Produce isotopically labeled protein (15N, 13C, 2H)
Optimize detergent micelles or nanodiscs for solution NMR
Consider solid-state NMR in lipid bilayers
Implement specific labeling schemes to overcome size limitations
Hybrid method integration:
Combine low-resolution data with computational modeling
Use crosslinking mass spectrometry to obtain distance constraints
Implement Rosetta membrane protein modeling with experimental restraints
Validate structural models using molecular dynamics simulations
These approaches provide complementary structural information that can be integrated to determine a high-resolution structure of HI_1297 in a membrane-like environment .
To elucidate the biological function of HI_1297 in Haemophilus influenzae, implement a comprehensive experimental strategy:
Genetic manipulation approaches:
Generate knockout or depletion strains in H. influenzae
Create complementation strains to verify phenotypes
Develop conditional expression systems for essential genes
Implement CRISPR interference for titratable gene repression
Phenotypic characterization:
Assess growth under various environmental conditions (pH, temperature, osmolarity)
Evaluate resistance to antibiotics and environmental stressors
Measure membrane permeability and potential
Examine biofilm formation and host cell interactions
Omics-based analyses:
Perform transcriptomics to identify affected pathways
Use proteomics to detect changes in protein expression profiles
Implement metabolomics to uncover altered metabolic pathways
Conduct lipidomics to examine membrane composition changes
Protein localization and dynamics:
Generate fluorescent protein fusions to track cellular localization
Implement super-resolution microscopy to define subcellular distribution
Use FRAP to measure protein mobility in the membrane
Employ pulse-chase experiments to determine protein turnover rates
This multifaceted approach will provide insights into the physiological role of HI_1297 and its potential as a therapeutic target in H. influenzae infections .
To comprehensively characterize potential post-translational modifications (PTMs) of HI_1297:
Mass spectrometry-based approaches:
Implement bottom-up proteomics with multiple proteases
Use top-down proteomics for intact protein analysis
Apply electron transfer dissociation for labile modification preservation
Perform targeted MS/MS for known modification sites
Modification-specific enrichment:
Employ phosphopeptide enrichment (TiO2, IMAC)
Use lectins for glycosylation enrichment
Implement antibody-based enrichment for specific modifications
Apply chemical labeling strategies for cysteine modifications
Site-directed mutagenesis validation:
Mutate identified modification sites to non-modifiable residues
Create phosphomimetic mutations (S/T→D/E)
Develop modification-specific antibodies for validation
Assess functional consequences of preventing modifications
In vivo dynamics:
Monitor modification changes under different growth conditions
Examine modification status during infection models
Track modifications during membrane insertion and maturation
Identify enzymes responsible for adding/removing modifications
This systematic approach will reveal whether HI_1297 undergoes PTMs that might regulate its function, localization, or interactions with other cellular components .
Several cutting-edge technologies show promise for advancing HI_1297 research:
Advanced structural biology approaches:
Micro-electron diffraction (MicroED) for small membrane protein crystals
Integrative structural biology combining cryo-EM, crosslinking-MS, and modeling
Time-resolved structural methods to capture folding intermediates
AI-based structure prediction specifically trained on membrane proteins
Single-molecule techniques:
Optical tweezers for membrane protein folding energetics
Single-molecule FRET to track conformational dynamics
Nanopore-based analysis of membrane protein insertion
High-speed AFM for real-time conformational changes
Advanced genetic approaches:
Genome-wide CRISPRi screens to identify genetic interactions
Deep mutational scanning for comprehensive structure-function mapping
In vivo directed evolution to identify functional variants
Synthetic biology approaches to reconstitute minimal systems
Computational advancements:
Enhanced molecular dynamics simulations with improved membrane force fields
Machine learning for prediction of membrane protein-protein interactions
Systems biology models incorporating membrane protein function
Integrative bioinformatics platforms for membrane proteome analysis
These emerging technologies will facilitate more detailed understanding of membrane protein biology generally and HI_1297 specifically, potentially leading to new therapeutic strategies targeting bacterial membrane proteins .
Knowledge gained from HI_1297 studies can have broad implications for membrane protein research:
Methodological advances:
Optimized protocols for small membrane protein expression and purification
Validated approaches for stability measurement applicable to other systems
Improved structural determination methods for multi-pass membrane proteins
Enhanced computational tools for membrane protein prediction
Biological insights:
Better understanding of membrane protein insertion pathways
Expanded knowledge of protein-lipid interactions in bacterial membranes
Improved models of membrane protein folding and stability
New paradigms for membrane protein quality control mechanisms
Translational applications:
Novel antibacterial strategies targeting membrane protein biogenesis
Improved approaches for membrane protein drug target identification
Enhanced methods for recombinant membrane protein production
New tools for studying disease-associated membrane protein mutations