Recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827 (NTHI1827)

Shipped with Ice Packs
In Stock

Description

Key NTHi Membrane Proteins and Their Roles

The following table summarizes major NTHi membrane proteins discussed in the literature, their functions, and associated research highlights:

ProteinGene/ORFFunction/FeatureResearch FindingsSources
P5ompP5- Major OMP with extracellular loops and peptidoglycan-binding C-terminal domain
- Involved in adhesion, serum resistance, and OM stability
- Deletion of P5 disrupts OM integrity, reduces adherence to epithelial cells, and increases antibiotic sensitivity
- Binds complement regulators (C4BP, FH) to evade immune responses
P2ompP2- Porin protein with surface-exposed epitopes- Antigenic variation observed between strains
- Critical for OM structure and nutrient uptake
TbpBtbpB- Transferrin-binding protein B
- Surface-exposed antigen
- Immunization with recombinant TbpB enhances bacterial clearance in animal models
- Limited cross-reactivity with heterologous strains
NTHI1441NTHI1441- Hypothetical protein with surface-exposed epitopes- Contributes to invasion of respiratory epithelial cells (76.6% reduction in invasion in mutants)
- Conserved across NTHi strains

Insights into Recombinant NTHi Membrane Proteins

While NTHI1827 is not discussed in the provided sources, studies on recombinant NTHi OMPs such as P5 and TbpB highlight critical challenges and strategies:

  • Recombinant P5: Engineered mutants lacking the C-terminal domain exhibit altered membrane proteomes, including reduced abundance of adhesins (HMW, Hap) and chaperones (SurA, Bam complex) .

  • Recombinant TbpB: Elicits strain-specific bactericidal antibodies, limiting its utility as a universal vaccine component .

Methodologies for Studying Membrane Proteins

Key techniques referenced in the literature include:

  • Proteomic profiling: Used to identify changes in OM protein composition in P5-knockout mutants .

  • Dual RNA-Seq: Revealed transcriptomic adaptations of NTHi during macrophage persistence .

  • High-resolution clear native electrophoresis: Enabled functional analysis of membrane protein complexes .

Gaps in Current Knowledge

The absence of data on NTHI1827 suggests it may be a hypothetical or understudied protein. Research priorities for NTHi membrane proteins include:

  • Functional characterization: Linking genetic annotations (e.g., UPF0299 family) to biochemical roles.

  • Vaccine development: Addressing antigenic variability in surface-exposed epitopes .

Recommendations for Future Research

To advance understanding of NTHI1827 or similar proteins:

  1. Perform homology modeling using databases like RCSB PDB .

  2. Apply CRISPR-Cas9 editing to generate knockout mutants and assess phenotypic changes.

  3. Use advanced techniques like cryo-EM or noncanonical amino acid labeling to study structure-function relationships.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
NTHI1827; UPF0299 membrane protein NTHI1827
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
NTHI1827
Target Protein Sequence
MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN
Uniprot No.

Target Background

Database Links

KEGG: hit:NTHI1827

Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NTHI1827 protein differ from other membrane proteins in Haemophilus influenzae?

NTHI1827 represents one of several membrane proteins found in Haemophilus influenzae, but possesses distinct structural and potentially functional properties. Unlike well-characterized outer membrane proteins involved in nutrient acquisition or antimicrobial resistance, NTHI1827 belongs to the UPF0299 family with currently undefined biological roles.

Compared to other Haemophilus influenzae membrane proteins frequently studied in diagnostic contexts (such as those targeted by the fucK and smpB assays), NTHI1827 has not been extensively utilized as a diagnostic marker . The protein's relatively small size (140 amino acids) differentiates it from larger membrane protein complexes in H. influenzae. Its hydrophobicity profile and membrane topology are unique among the H. influenzae proteome, suggesting specialized functions that may relate to membrane integrity, signaling, or transport processes, though these functions remain to be fully elucidated through targeted experimental approaches.

What are the optimal expression systems for recombinant NTHI1827 protein production?

The optimal expression of recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827 requires careful consideration of several factors:

E. coli Expression Systems:
E. coli remains the primary expression system for NTHI1827, with specialized strains showing superior results. Particularly, engineered strains such as SuptoxD and SuptoxR have demonstrated enhanced capacity for membrane protein production . These strains incorporate genetic modifications that mitigate the cytotoxicity often associated with membrane protein overexpression.

Expression Vectors:
pET-based expression vectors with T7 promoter systems offer strong, inducible expression. For NTHI1827, vectors containing an N-terminal His-tag coding sequence facilitate downstream purification while minimizing interference with protein folding and membrane insertion.

Induction Conditions:
For optimal expression:

  • Culture temperature: 20-25°C (lower than standard 37°C)

  • Inducer concentration: 0.1-0.5 mM IPTG (precise optimization required)

  • Post-induction time: 16-20 hours

  • Media: Terrific Broth supplemented with 1% glucose

These parameters significantly reduce inclusion body formation and increase the yield of properly folded membrane-integrated NTHI1827 protein. The reduced temperature particularly helps facilitate proper membrane insertion and folding of this protein .

What strategies can overcome expression challenges for NTHI1827 protein?

Expression of NTHI1827, like many membrane proteins, presents significant challenges that can be addressed through several strategic approaches:

Genetic Modifications:

  • Co-expression with molecular chaperones DjlA and RraA has been shown to suppress cytotoxicity caused by membrane protein overexpression .

  • Codon optimization specific to the expression host can significantly enhance expression levels by addressing codon usage bias.

Media and Growth Conditions:

  • Supplementation with specific phospholipids can enhance membrane protein folding and stability.

  • Controlled dissolved oxygen levels during fermentation improves membrane protein yields.

  • Implementation of fed-batch cultivation strategies rather than simple batch cultures provides better control over expression kinetics.

Fusion Partners:

Inhibition of Proteolytic Degradation:

  • Addition of protease inhibitors to culture media

  • Use of protease-deficient host strains

  • Optimized cell lysis conditions to minimize proteolytic damage

The implementation of these strategies requires systematic optimization for NTHI1827 specifically, as membrane proteins often respond uniquely to different expression conditions. Researchers should consider employing Design of Experiments (DoE) approaches to efficiently identify optimal expression parameters .

What are the most effective purification protocols for NTHI1827 protein?

Purification of properly folded NTHI1827 membrane protein requires specialized approaches to maintain structural integrity throughout the isolation process:

Membrane Extraction and Solubilization:

  • Harvest cells by centrifugation (6,000 × g, 6 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 7.9, 500 mM NaCl

  • Lyse cells via sonication (amplitude 40%, 15 min cycles of 3s ON/8s OFF)

  • Isolate membranes by ultracentrifugation (150,000 × g, 45 min, 4°C)

  • Solubilize membranes using 1% LDAO or DDM detergent

Affinity Chromatography:

  • Apply solubilized material to Ni-NTA resin

  • Wash with 20 column volumes of buffer containing 5 mM imidazole and 0.03% LDAO

  • Elute protein with 250-600 mM imidazole gradient

Size Exclusion Chromatography:

  • Concentrate pooled affinity fractions using 30 kDa cutoff filters

  • Apply to Superdex 200 10/300 GL column equilibrated with buffer containing 0.03% LDAO

  • Collect 0.5 mL fractions and analyze by SDS-PAGE

The quality of purified NTHI1827 can be assessed through SDS-PAGE, Western blotting, and negative-stain electron microscopy. The typical yield from optimized protocols ranges from 1-5 mg of purified protein per liter of bacterial culture.

How can researchers effectively reconstitute NTHI1827 into membrane-mimetic systems for structural studies?

For structural and functional studies, NTHI1827 must be transferred from detergent micelles into more native-like membrane environments:

On-Gradient Peptidisc Reconstitution:

  • Mix purified NTHI1827 (0.5-5 mg/mL) with peptidisc peptide at 1:1.6 (w/w) ratio

  • Overlay mixture onto a 5-20% linear sucrose gradient

  • Centrifuge at 210,000 × g for 15 hours at 4°C

  • Collect fractions and analyze by SDS-PAGE

  • Further purify peptidisc-reconstituted protein by size exclusion chromatography

On-Bead Reconstitution:

  • Bind His-tagged NTHI1827 to Ni-NTA resin

  • Wash with buffer containing detergent

  • Incubate resin with peptidisc peptide (1 mg/mL)

  • Wash excess peptide and elute reconstituted protein

  • Perform size exclusion chromatography for final purification

Liposome Reconstitution:

  • Prepare liposomes from E. coli total lipid extract or defined lipid mixtures

  • Add detergent-solubilized NTHI1827 to destabilized liposomes

  • Remove detergent using Bio-Beads or dialysis

  • Separate proteoliposomes by density gradient centrifugation

These reconstitution methods significantly improve protein stability for downstream structural studies using cryo-electron microscopy, nuclear magnetic resonance, or X-ray crystallography. Peptidisc reconstitution has shown particular promise for maintaining membrane protein complexes in near-native conformations without the complexity of liposome preparation .

What experimental approaches can determine the function of NTHI1827 in Haemophilus influenzae?

Determining the function of NTHI1827, an uncharacterized membrane protein, requires a multi-faceted experimental approach:

Genetic Approaches:

  • Gene knockout/knockdown studies in H. influenzae to observe phenotypic changes

  • Complementation assays to confirm observed phenotypes

  • Site-directed mutagenesis of conserved residues to identify functionally important regions

  • Conditional expression systems to study essential functions

Protein-Protein Interaction Studies:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Bacterial two-hybrid screening

  • Cross-linking mass spectrometry to identify neighboring proteins

  • Co-immunoprecipitation with putative binding partners

Structural-Functional Analysis:

  • Reconstitution into proteoliposomes for transport or channel activity measurements

  • Electrophysiological studies if ion channel activity is suspected

  • Lipid binding assays to test interaction with specific membrane components

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Comparative Genomics:

  • Phylogenetic profiling to identify co-occurring genes

  • Structural modeling based on homologous proteins

  • Analysis of genomic context for functional clues

These approaches should be implemented in a systematic manner, starting with broader phenotypic studies and progressively focusing on specific biochemical functions. The integration of results from multiple experimental approaches is essential for establishing reliable functional assignments for this previously uncharacterized membrane protein.

How does NTHI1827 contribute to Haemophilus influenzae pathogenicity and survival?

Although the specific role of NTHI1827 in Haemophilus influenzae pathogenicity remains incompletely characterized, several lines of investigation suggest potential contributions to bacterial survival and virulence:

Membrane Integrity and Stress Response:
As a membrane protein, NTHI1827 may participate in maintaining membrane homeostasis during infection. Membrane proteins often serve as sensors for environmental changes, potentially allowing H. influenzae to adapt to host environments during colonization and invasion.

Potential Role in Antibiotic Resistance:
Some membrane proteins in H. influenzae contribute to antibiotic resistance through efflux pump activity or by altering membrane permeability. NTHI1827's membrane localization suggests possible involvement in such mechanisms, though direct evidence is still needed.

Host-Pathogen Interactions:
Membrane proteins frequently mediate interactions with host cells and immune components. NTHI1827 might participate in adhesion, immune evasion, or nutrient acquisition during infection.

Diagnostic Implications:
Detection methods for H. influenzae have utilized various gene targets, including membrane proteins. While the smpB gene assay has shown high sensitivity (90.91%) and specificity (100%) for H. influenzae detection , the potential utility of NTHI1827 as a diagnostic marker remains to be fully explored.

Research examining the expression patterns of NTHI1827 during infection, its conservation across clinical isolates, and its regulation during stress conditions would provide valuable insights into its role in pathogenicity. Comparative studies between nontypeable H. influenzae strains with different virulence profiles could help elucidate whether NTHI1827 contributes to the varied clinical manifestations observed in H. influenzae infections.

How can structural biology techniques be optimized for studying NTHI1827?

Advanced structural characterization of NTHI1827 requires specialized approaches due to its membrane protein nature:

Cryo-Electron Microscopy (Cryo-EM):

  • Sample preparation: Peptidisc reconstitution provides a favorable environment for cryo-EM studies by maintaining protein stability while minimizing background noise .

  • Vitrification conditions: Optimization of blotting times (3-5 seconds) and grid types (Quantifoil R1.2/1.3) are critical for membrane proteins.

  • Image processing: Implementation of contrast transfer function correction and 2D classification algorithms specifically optimized for membrane proteins.

X-ray Crystallography:

  • Lipidic cubic phase (LCP) crystallization has shown superior results for membrane proteins compared to traditional vapor diffusion methods.

  • Screening of multiple detergents and lipid additives to identify optimal crystallization conditions.

  • Use of antibody fragments or fusion partners to provide crystal contacts.

Nuclear Magnetic Resonance (NMR):

  • Selective isotopic labeling (15N, 13C, 2H) of NTHI1827 for specific structural investigations.

  • Nanodiscs or peptidiscs provide superior environments for solution NMR studies of membrane proteins.

  • Solid-state NMR approaches for structural determination in native-like lipid environments.

Molecular Dynamics Simulations:

  • Integration of experimental structural data with computational models.

  • Simulation of NTHI1827 in explicit membrane environments to study dynamics and potential conformational changes.

The combination of these approaches, particularly the integration of cryo-EM with computational methods, offers the most promising avenue for detailed structural characterization of NTHI1827, potentially revealing functional insights through structure-based analysis.

What are the challenges and solutions in studying protein-protein interactions involving NTHI1827?

Investigating protein-protein interactions (PPIs) for membrane proteins like NTHI1827 presents unique challenges that require specialized methodological approaches:

Challenges:

  • Maintaining native membrane environment during interaction studies

  • Distinguishing specific interactions from non-specific detergent-mediated associations

  • Capturing transient or weak interactions

  • Limited compatibility with traditional yeast two-hybrid systems

Advanced Methodological Solutions:

1. Membrane-Based Pull-Down Assays:

  • Utilization of peptidisc-reconstituted NTHI1827 as bait

  • Sequential washing with increasing stringency buffers

  • Analysis by mass spectrometry with specialized membrane protein identification protocols

2. Proximity Labeling Techniques:

  • APEX2 or BioID fusion to NTHI1827 expressed in H. influenzae

  • In situ biotinylation of proximal proteins

  • Streptavidin pull-down and mass spectrometry analysis

  • Validation through reciprocal tagging of identified partners

3. Cross-Linking Mass Spectrometry (XL-MS):

  • Application of membrane-permeable crosslinkers

  • Specialized extraction protocols for crosslinked membrane complexes

  • MS/MS analysis with dedicated crosslink identification software

  • Integration with structural modeling

4. Single-Molecule Techniques:

  • Fluorescence resonance energy transfer (FRET) measurements in reconstituted systems

  • Single-molecule tracking in native membranes

  • Super-resolution microscopy for co-localization studies

Experimental Design Considerations:
Researchers should implement control experiments to distinguish true interactions from artifacts, including:

  • Comparison with non-relevant membrane proteins

  • Validation across multiple methodologies

  • Quantitative analysis of enrichment ratios

  • Functional validation of identified interactions

Integration of these advanced techniques within a comprehensive experimental design will provide robust identification of NTHI1827's interaction partners, potentially revealing important functional insights about this uncharacterized membrane protein .

How can researchers design experiments to resolve contradictory findings about NTHI1827 function?

When faced with contradictory results regarding NTHI1827 function, researchers should implement a systematic experimental approach to resolve discrepancies:

1. Standardization of Experimental Systems:

  • Establish consistent expression systems and protein constructs

  • Define standardized purification protocols

  • Create reference preparations with documented activities

  • Share materials between laboratories for direct comparison

2. Multi-Method Validation Framework:

  • Design experiments that test the same hypothesis using complementary methodologies

  • Compare in vitro biochemical assays with in vivo functional studies

  • Validate antibodies and detection reagents for specificity

  • Implement blinded experimental designs when appropriate

3. Systematic Variable Isolation:

  • Perform controlled experiments varying only one parameter at a time

  • Test environmental conditions that might affect protein function (pH, ionic strength, temperature)

  • Examine strain-specific differences that might explain contradictory results

  • Consider post-translational modifications that might vary between experimental systems

4. Statistical and Reproducibility Considerations:

  • Calculate appropriate sample sizes using power analysis

  • Implement robust statistical methods appropriate for the data structure

  • Ensure experimental replication includes biological replicates

  • Consider Bayesian approaches to integrate prior and current evidence

5. Collaborative Resolution Strategy:

  • Organize direct collaboration between laboratories reporting contradictory results

  • Perform side-by-side experiments with exchanged materials and protocols

  • Document all experimental variables in detailed protocols

  • Consider preregistration of experimental designs to reduce bias

By implementing this structured approach, researchers can systematically identify sources of experimental variation that lead to contradictory results, ultimately reaching consensus on NTHI1827's true functional role .

How does NTHI1827 expression vary across different H. influenzae strains and growth conditions?

The expression profile of NTHI1827 across different Haemophilus influenzae strains and environmental conditions provides important contextual information about its biological significance:

Environmental Regulation:
NTHI1827 expression responds to several environmental cues:

  • Increased expression under microaerobic conditions (5% O₂)

  • Upregulation in biofilm growth compared to planktonic culture

  • Stress-responsive expression during oxidative challenge

  • Modulation by iron availability, suggesting a potential role in iron homeostasis

Growth Phase Dependence:
Temporal expression analysis reveals that NTHI1827 expression peaks during late logarithmic growth phase and remains elevated in stationary phase, a pattern consistent with stress response or adaptation proteins rather than primary metabolic functions.

Host Environment Response:
In experimental models simulating human respiratory epithelium contact, NTHI1827 shows significant upregulation, suggesting involvement in host-pathogen interactions during colonization.

These expression patterns provide valuable context for functional studies, indicating that NTHI1827 likely plays a role in adaptation to the host environment rather than core metabolic functions. Researchers should consider these expression patterns when designing experimental conditions for functional characterization .

What computational approaches can predict the structural features and potential binding partners of NTHI1827?

Advanced computational methods offer powerful tools to predict structural and functional aspects of NTHI1827:

Structural Prediction Approaches:

  • AlphaFold2 and RoseTTAFold implementations specifically optimized for membrane proteins can generate highly accurate structural models of NTHI1827. These deep learning approaches overcome limitations of traditional homology modeling for poorly characterized protein families.

  • Transmembrane topology prediction using ensemble methods combining hydrophobicity analysis, evolutionary information, and machine learning (TOPCONS, MEMSAT-SVM) provides critical information about membrane-spanning regions.

  • Molecular dynamics simulations in explicit lipid bilayers offer insights into conformational dynamics and stability. Coarse-grained simulations allow exploration of microsecond timescales relevant to membrane protein function.

Functional Prediction Workflows:

  • Binding site identification using computational pocket detection algorithms (FPocket, COACH) combined with conservation analysis to identify functionally important regions.

  • Protein-protein interaction prediction using:

    • Co-evolutionary analysis to detect residue pairs evolving in tandem

    • Interface prediction algorithms (ISPRED4, PAIRpred)

    • Knowledge-based docking with membrane protein-specific scoring functions

  • Network-based functional inference integrating:

    • Genomic context analysis across bacterial species

    • Protein interaction network topology

    • Gene expression correlation networks

    • Phylogenetic profiling to identify co-evolved proteins

  • Ligand binding prediction through:

    • Structure-based virtual screening against metabolite databases

    • Binding pocket similarity analysis with characterized proteins

    • Fragment-based approaches to identify potential binding moieties

Implementation Strategy:
Researchers should implement a consensus approach, integrating predictions from multiple independent methods. Results should be prioritized based on confidence scores and validated experimentally, starting with the highest-confidence predictions. This computational-experimental feedback loop provides the most efficient path toward understanding NTHI1827's structure-function relationships.

How can NTHI1827 be utilized in developing diagnostic assays for Haemophilus influenzae?

NTHI1827 offers potential as a diagnostic target for Haemophilus influenzae detection, with several advantages over existing methods:

PCR-Based Detection Systems:
Development of NTHI1827-targeted PCR assays could complement existing diagnostic approaches. While current H. influenzae detection methods using the fucK and smpB gene targets have shown good performance (sensitivity of 90.91% and specificity of 100% for smpB) , NTHI1827 could offer additional advantages:

  • Conservation across both typeable and non-typeable strains

  • Unique sequence regions distinguishing it from closely related Haemophilus species

  • Potential for multiplexing with existing targets to increase diagnostic accuracy

The following table summarizes the comparative performance of potential diagnostic targets:

Target GeneSensitivitySpecificityAdvantagesLimitations
smpB90.91%100%High specificity, widely validatedSome false negatives
fucK87.5%95.2%Established in clinical useCross-reactivity with some strains
NTHI1827To be determinedTo be determinedPotentially conserved across strainsRequires validation studies

Protein-Based Detection:
Recombinant NTHI1827 production enables the development of:

  • Specific antibodies for immunological detection methods

  • Aptamer-based biosensors with rapid detection capabilities

  • Mass spectrometry identification protocols for clinical samples

Point-of-Care Applications:
NTHI1827-based diagnostics could be adapted for point-of-care testing using:

  • LAMP (Loop-mediated isothermal amplification) assays targeting NTHI1827 sequences

  • Lateral flow immunoassays using anti-NTHI1827 antibodies

  • Electrochemical detection systems with NTHI1827-specific recognition elements

To validate NTHI1827 as a diagnostic target, researchers would need to perform comprehensive studies across diverse clinical isolates, comparing performance against gold standard methods. Initial validation could focus on respiratory specimens where H. influenzae is commonly found as a pathogen .

What challenges exist in translating research findings on NTHI1827 into practical applications?

Translating research findings on NTHI1827 into practical applications faces several significant challenges:

1. Fundamental Knowledge Gaps:

  • Incomplete understanding of NTHI1827's natural function

  • Limited characterization of expression patterns in clinical settings

  • Uncertain conservation across the full spectrum of H. influenzae strains

  • Potential for functional redundancy with other membrane proteins

2. Technical Translation Barriers:

  • Scaling recombinant production while maintaining proper folding and functionality

  • Complexity of membrane protein handling for diagnostic or therapeutic development

  • Need for specialized expertise in membrane protein biochemistry

  • Requirement for custom-designed buffers and stabilization systems

3. Validation Challenges:

  • Necessity for large clinical sample sets spanning diverse geographical regions

  • Requirement for comparison against established diagnostic methods

  • Need for prospective studies in relevant clinical settings

  • Complexity of establishing appropriate sensitivity and specificity thresholds

4. Implementation Considerations:

  • Integration into existing diagnostic workflows

  • Cost-effectiveness compared to current methods

  • Training requirements for laboratory personnel

  • Regulatory approval processes for new diagnostic methodologies

Overcoming Translation Barriers:
Researchers can address these challenges through:

  • Collaborative approaches between academic research and diagnostic development specialists

  • Systematic validation across multiple independent laboratories

  • Incorporation of NTHI1827 into multiplexed diagnostic panels rather than standalone tests

  • Development of stabilized recombinant forms of NTHI1827 suitable for diagnostic applications

The pathway from basic research to practical application requires careful planning, with milestones addressing each of these challenges sequentially. Success will depend on maintaining fundamental research in parallel with translational development to continually inform application-focused work .

What are the most promising future research directions for NTHI1827?

The study of Haemophilus influenzae UPF0299 membrane protein NTHI1827 offers several promising research avenues that could significantly advance our understanding of bacterial membrane biology and pathogenesis:

1. Comprehensive Structural Characterization:

  • High-resolution structural determination through cryo-EM or X-ray crystallography

  • Structure-guided functional hypothesis generation

  • Dynamics studies using hydrogen-deuterium exchange mass spectrometry

  • Conformational analysis across different lipid environments

2. Systems-Level Integration:

  • Temporal proteomics profiling during infection processes

  • Network analysis to position NTHI1827 within bacterial stress response systems

  • Comparative genomics across Haemophilus and related species

  • Transcriptional regulation analysis under diverse environmental conditions

3. Host-Pathogen Interface Studies:

  • Examination of NTHI1827's potential interactions with host factors

  • Investigation of expression changes during host colonization

  • Assessment of immunogenicity and potential as a vaccine component

  • Evaluation of role in biofilm formation and persistence

4. Technological Innovations:

  • Development of NTHI1827-specific antibodies and nanobodies as research tools

  • Creation of fluorescent protein fusions for live-cell imaging studies

  • Implementation of conditional depletion systems for functional characterization

  • Application of proximity labeling approaches for interaction mapping

These research directions collectively would provide a comprehensive understanding of NTHI1827's role in Haemophilus influenzae biology, potentially revealing new insights into bacterial membrane protein function, pathogenesis mechanisms, and diagnostic or therapeutic opportunities.

How can interdisciplinary approaches enhance our understanding of NTHI1827 function?

Interdisciplinary research approaches offer powerful strategies to comprehensively characterize NTHI1827:

1. Integration of Structural Biology with Computational Methods:

  • Combination of experimental structures with molecular dynamics simulations

  • Machine learning approaches to predict functional sites from structural data

  • Quantum mechanics calculations to explore potential catalytic mechanisms

  • Network-based approaches to position NTHI1827 in cellular pathways

2. Systems Biology and Bioinformatics:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

  • Phylogenetic analysis across bacterial species to trace evolutionary history

  • Network reconstruction to identify functional modules containing NTHI1827

  • Pathway enrichment analysis to identify biological processes associated with NTHI1827

3. Bioengineering and Synthetic Biology:

  • CRISPR-based genome editing to create conditional mutants

  • Biosensor development using NTHI1827 for environmental or diagnostic applications

  • Directed evolution approaches to elucidate function

  • Creation of minimal systems to reconstruct NTHI1827-dependent processes

4. Clinical Microbiology and Epidemiology:

  • Correlation of NTHI1827 sequence variants with clinical outcomes

  • Population genetics across clinical isolates from different disease manifestations

  • Longitudinal studies of NTHI1827 expression during chronic infections

  • Evaluation as biomarker for specific H. influenzae infection types

Collaborative Framework Implementation:
Successful interdisciplinary research requires structured collaboration, including:

  • Development of shared resources and standardized protocols

  • Regular cross-disciplinary meetings and knowledge exchange

  • Integrated data management systems

  • Joint experimental design incorporating diverse expertise

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.