Recombinant Haemophilus influenzae UPF0761 membrane protein HI_0276 (HI_0276)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant HI_0276 is expressed in E. coli and purified via nickel-affinity chromatography due to its His-tag. Key production parameters include:

  • Expression Conditions: Growth in standard E. coli media, followed by induction (e.g., IPTG) .

  • Purification: Lyophilized powder stored at -20°C/-80°C to prevent degradation .

  • Reconstitution: Suggested in deionized sterile water (0.1–1.0 mg/mL), with optional glycerol addition for stability .

Immunological Research

While HI_0276 itself is non-lipidated, lipidation of similar H. influenzae proteins (e.g., OMP26) enhances immune recognition via TLR2 . Although HI_0276’s lipidation status is not explicitly studied, its recombinant form serves as a control in vaccine-related research.

Diagnostic and Therapeutic Use

  • ELISA Reagents: Recombinant HI_0276 is used in enzyme-linked immunosorbent assays to detect anti-H. influenzae antibodies .

  • Vaccine Development: While not directly tested, similar H. influenzae proteins (e.g., Hi-PAL/P6) have shown efficacy in eliciting protective antibodies, suggesting potential for HI_0276 in multi-antigen vaccine strategies .

Comparative Analysis with Lipidated Proteins

Studies on lipidated H. influenzae proteins (e.g., OMP26) reveal that lipidation modulates immune responses. For example:

Protein FormImmune ResponseSource
Non-lipidated (NL)Lower TLR2 activation but still induces adaptive immunity
Diacylated (L)Stronger TLR2 activation, higher adaptive immune responses
Triacylated (L)Reduced immune stimulation compared to diacylated forms

HI_0276, being non-lipidated, may exhibit similar immunogenic profiles to NL-OMP26 but lacks direct experimental validation.

Population Genetics and Resistance

Recent genomic studies highlight H. influenzae’s global diversity and multidrug resistance, emphasizing the need for novel vaccine targets. While HI_0276 is not directly implicated in resistance, its membrane localization positions it as a potential therapeutic target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please clearly indicate your desired format during order placement, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which serves as a reference for your convenience.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
HI_0276; UPF0761 membrane protein HI_0276
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Target Names
HI_0276
Target Protein Sequence
MISLKNFGLLFWKRFSENKLNQVAGALTYSTMLAMVPLVMVIFSIFSAFPVFNEVTGELK EMIFTNFAPSASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQ SRSPLSSFAIYWMILTLGPLIIGVSIGISSYIKIMFEQSEHLSLGLKLLSFVPFLFTWFI FTLIYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYIVTFPSYQLIYGAMATLPIML LWIQISWLVVLVGAQLASTLDEIGEQIEQ
Uniprot No.

Target Background

Database Links

KEGG: hin:HI0276

STRING: 71421.HI0276

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein HI_0276 and what is its significance in research?

The UPF0761 membrane protein HI_0276 is a transmembrane protein encoded by the HI_0276 gene in Haemophilus influenzae. The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein has been identified, its specific biological function remains largely unknown. The protein consists of 269 amino acids and is predicted to have multiple transmembrane domains. As a membrane protein, it likely plays roles in cellular processes such as signaling, transport, or maintaining membrane integrity. The protein is significant in pathogenicity research as membrane proteins often mediate interactions between bacterial pathogens and their hosts .

How can sequence analysis help predict the structure and function of HI_0276?

Sequence analysis provides several insights into the potential structure and function of HI_0276:

  • Transmembrane topology prediction: Tools like TMHMM, MEMSAT, or Phobius can analyze hydrophobicity patterns to predict membrane-spanning regions.

  • Conserved domain identification: Analysis of conserved sequences within the UPF0761 family can reveal functional motifs.

  • Homology-based inference: Comparison with characterized proteins from the same family in other organisms may suggest functional roles.

  • Evolutionary conservation analysis: Highly conserved residues often indicate functional or structural importance.

  • Post-translational modification site prediction: Identification of potential glycosylation, phosphorylation, or other modification sites.

What are the optimal conditions for expressing recombinant HI_0276 protein?

For optimal expression of recombinant HI_0276, researchers should consider the following parameters:

Expression System:

  • E. coli is successfully used as the expression host for this membrane protein

  • BL21(DE3), C41(DE3), or C43(DE3) strains are recommended for membrane protein expression

Vector and Construct Design:

  • The protein is typically expressed with an N-terminal His-tag for purification

  • T7 promoter-based expression systems provide controlled induction

  • Signal sequence modification may be necessary for proper membrane insertion

Induction Parameters:

  • Temperature: 16-20°C often improves membrane protein folding

  • IPTG concentration: 0.1-0.5 mM for T7 promoter systems

  • Induction time: 16-24 hours at lower temperatures

Media and Supplements:

  • Rich media (TB or 2XYT) supplemented with 0.5-1% glucose

  • Addition of 0.5-1% glycerol to stabilize membrane proteins

  • Potential membrane-stabilizing compounds or specific lipids

Researchers should monitor expression using SDS-PAGE and Western blotting with anti-His antibodies to optimize conditions for their specific laboratory setup .

What purification strategy is most effective for recombinant His-tagged HI_0276?

An efficient multi-step purification strategy for His-tagged HI_0276 includes:

1. Membrane Isolation:

  • Cell harvesting by centrifugation (5,000 × g, 15 min, 4°C)

  • Resuspension in buffer containing protease inhibitors

  • Cell disruption via sonication or high-pressure homogenization

  • Removal of cell debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour, 4°C)

2. Protein Solubilization:

  • Resuspend membranes in buffer containing:

    • 20 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 1-2% detergent (n-dodecyl-β-D-maltoside or n-octyl-β-D-glucopyranoside)

    • 10% glycerol

    • Protease inhibitors

  • Incubate with gentle rotation (2-4 hours at 4°C)

  • Remove insoluble material by ultracentrifugation

3. Immobilized Metal Affinity Chromatography (IMAC):

  • Load solubilized protein onto Ni-NTA column

  • Wash with buffer containing low imidazole (20-40 mM)

  • Elute with imidazole gradient (50-500 mM)

4. Size Exclusion Chromatography:

  • Further purify using gel filtration with buffer containing reduced detergent concentration

5. Quality Assessment:

  • Analyze purity by SDS-PAGE (target >90% purity)

  • Confirm identity via Western blot or mass spectrometry

This approach has been shown to yield high-purity recombinant membrane proteins suitable for structural and functional studies .

How should recombinant HI_0276 be stored to maintain stability and activity?

For optimal stability and preservation of HI_0276 activity, the following storage conditions are recommended:

Short-term Storage (up to 1 week):

  • Store at 4°C in buffer containing:

    • Tris/PBS-based buffer, pH 8.0

    • 150-300 mM NaCl

    • Appropriate detergent concentration

  • Avoid repeated freeze-thaw cycles

Long-term Storage:

  • Store at -20°C/-80°C in aliquots to minimize freeze-thaw cycles

  • Add 5-50% glycerol before freezing; 50% final concentration is recommended

  • Alternatively, lyophilize the protein for extended storage

Reconstitution of Lyophilized Protein:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For functional studies, consider reconstitution into lipid bilayers or nanodiscs

Stability Monitoring:

  • Periodically check protein integrity by SDS-PAGE

  • Assess functional activity using appropriate assays

  • Monitor for aggregation using dynamic light scattering

Following these guidelines helps maintain structural integrity and functional properties during storage, ensuring reliable experimental results .

What techniques are most effective for determining the structure of HI_0276?

Several complementary techniques can be employed for structural determination of HI_0276:

X-ray Crystallography:

  • Gold standard for high-resolution structures of membrane proteins

  • Requires successful crystallization, often challenging for membrane proteins

  • Strategies include detergent screening, lipidic cubic phase crystallization, and use of stabilizing partners

Cryo-Electron Microscopy (cryo-EM):

  • Increasingly powerful for membrane protein structure determination

  • Does not require crystallization

  • Sample preparation involves vitrification in detergent micelles, nanodiscs, or liposomes

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Provides dynamic information not available from static structures

  • Requires isotopic labeling (15N, 13C, 2H)

  • Solution NMR using detergent micelles or solid-state NMR in lipid bilayers

Computational Structure Prediction:

  • RosettaMembrane can predict structures with increasing accuracy

  • Most valuable when integrated with experimental constraints

Hybrid Approaches:

  • Combining low-resolution experimental data with computational modeling

  • Cross-linking mass spectrometry to identify spatial proximities

  • EPR spectroscopy to define distances between specific residues

For HI_0276, an integrated approach using RosettaMembrane prediction followed by experimental validation would be most practical .

How can RosettaMembrane be used to model the structure of HI_0276?

RosettaMembrane, a specialized membrane protein modeling tool, can be applied to HI_0276 structure prediction through the following workflow:

1. Preparation Steps:

  • Generate multiple sequence alignment of HI_0276 homologs

  • Predict transmembrane spans using dedicated tools

  • Define membrane embedding parameters (thickness, orientation)

2. Ab initio Modeling:

  • Use membrane_abinitio application in Rosetta

  • Generate fragments from the HI_0276 sequence

  • Set up membrane environment parameters

  • Generate 10,000-50,000 models

  • Select top models based on RosettaMembrane energy scores

3. Comparative Modeling (if templates exist):

  • Identify structural templates using HHpred

  • Create alignments between HI_0276 and template structures

  • Use membrane_comparative modeling protocols

  • Refine models within the membrane environment

4. Model Refinement:

  • Apply membrane-specific refinement protocols

  • Optimize side-chain packing in different membrane regions

  • Minimize energy in the context of the membrane environment

5. Model Validation:

  • Assess models using RosettaMembrane energy metrics

  • Compare predicted and experimentally determined TM spans

  • Evaluate stereochemical quality using MolProbity

Research has demonstrated that RosettaMembrane recovers native-like amino acid composition in membrane proteins and produces models with realistic surface hydrophobicity, making it currently the best option for modeling membrane proteins like HI_0276 .

What experimental validation methods can confirm structural predictions of HI_0276?

To validate computational structural predictions of HI_0276, researchers should employ these experimental approaches:

Site-Directed Mutagenesis:

  • Mutate predicted functionally important residues

  • Assess effects on protein folding, stability, and function

  • Target predicted transmembrane regions and soluble domains separately

Cross-Linking Mass Spectrometry:

  • Introduce cysteine pairs at predicted proximal residues

  • Perform disulfide cross-linking experiments

  • Analyze cross-linked products by mass spectrometry to confirm spatial relationships

Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Map solvent-accessible regions of the protein

  • Compare accessibility patterns with predicted structural features

  • Identify protected regions consistent with transmembrane domains

Spectroscopic Techniques:

  • Circular dichroism to assess secondary structure content

  • Fluorescence spectroscopy with introduced tryptophan residues

  • EPR spectroscopy with site-directed spin labeling

Limited Proteolysis:

  • Identify protected regions resistant to proteolytic digestion

  • Compare with predicted structural elements

  • Map domain boundaries and flexible regions

Functional Assays Based on Structure:

  • Design assays to test hypotheses derived from structural models

  • Assess the effects of mutations on predicted functional sites

  • Evaluate ligand binding or transport activity based on structural features

These validation methods provide experimental evidence to support or refine computational models, creating an iterative process of structural elucidation .

What approaches can be used to investigate the function of the uncharacterized HI_0276 protein?

A comprehensive strategy to determine the function of uncharacterized HI_0276 includes:

Genomic Context Analysis:

  • Examine neighboring genes in the H. influenzae genome

  • Identify conserved gene clusters across bacterial species

  • Apply guilt-by-association principles to infer potential functions

Bioinformatic Prediction:

  • Perform detailed sequence analysis for functional motifs

  • Identify conserved domains using Pfam, InterPro, or CDD

  • Apply machine learning-based function prediction tools

Protein-Protein Interaction Studies:

  • Pull-down assays using His-tagged HI_0276 as bait

  • Bacterial two-hybrid screening

  • Cross-linking followed by mass spectrometry

  • Co-immunoprecipitation with candidate interactors

Gene Deletion and Complementation:

  • Generate HI_0276 knockout in H. influenzae

  • Characterize phenotypic changes (growth, morphology, stress response)

  • Perform rescue experiments with wild-type and mutant versions

  • Conduct transcriptomic/proteomic analysis of knockout strains

Localization and Trafficking:

  • Fluorescent protein fusions to determine subcellular localization

  • Immunogold electron microscopy for precise membrane localization

  • Fractionation studies to confirm membrane association

Functional Assays:

  • Test for membrane transport activities

  • Assess signal transduction capabilities

  • Screen for enzymatic activities

  • Measure effects on membrane integrity

By systematically applying these approaches, researchers can develop testable hypotheses about the biological role of HI_0276 .

How might structural characteristics of HI_0276 guide functional investigations?

The structural features of HI_0276 can inform functional studies through several research approaches:

Analysis of Transmembrane Topology:

  • The number and arrangement of transmembrane helices suggest potential functions:

    • 6-12 helices often indicate transporter activity

    • 7 helices are common in G-protein coupled receptors

    • 4-6 helices may suggest channel-forming capabilities

Identification of Conserved Motifs:

  • Analyze the 269-amino acid sequence for known functional motifs

  • Look for characteristic patterns such as:

    • ATP-binding cassette signatures

    • Ion coordination sites

    • Substrate binding pockets

    • Signal transduction domains

Pocket and Cavity Analysis:

  • Examine the predicted structure for binding pockets

  • Assess the electrostatic and hydrophobic properties of cavities

  • Compare with known binding sites in related proteins

Protein Surface Properties:

  • Analyze surface charge distribution

  • Identify potential protein-protein interaction interfaces

  • Look for lipid-binding regions

Conformational Dynamics Prediction:

  • Predict flexible regions that might be involved in conformational changes

  • Identify potential hinge regions or dynamic domains

  • Model possible conformational states

Comparative Structural Analysis:

  • Compare the HI_0276 structure with functionally characterized proteins

  • Look for structural similarities that might suggest functional homology

  • Identify shared structural features with proteins of known function

These structure-based insights can guide the design of targeted experiments to test specific functional hypotheses about HI_0276 .

What role might HI_0276 play in Haemophilus influenzae pathogenicity?

As a membrane protein in a pathogenic bacterium, HI_0276 may contribute to virulence through several potential mechanisms:

Host-Pathogen Interactions:

  • Membrane proteins often mediate adhesion to host cells

  • HI_0276 could function as an adhesin facilitating colonization

  • It may participate in biofilm formation, a key virulence determinant

Immune Evasion:

  • Some membrane proteins contribute to antigenic variation

  • HI_0276 might be involved in masking surface epitopes

  • It could participate in resistance to host defense mechanisms

Nutrient Acquisition:

  • Membrane transporters are crucial for obtaining nutrients in the host

  • HI_0276 might function in acquiring essential nutrients

  • Similar to other H. influenzae proteins, it could be involved in heme transport, critical for in vivo growth

Stress Response and Adaptation:

  • Membrane proteins often sense and respond to environmental cues

  • HI_0276 might function in adaptation to host microenvironments

  • It could participate in acid tolerance or resistance to antimicrobial peptides

Secretion Systems:

  • Bacterial pathogens use specialized secretion systems for virulence factor delivery

  • HI_0276 might be a component of such systems

  • It could play a structural or regulatory role in a secretion apparatus

To investigate these possibilities, researchers should conduct comparative studies between pathogenic and non-pathogenic H. influenzae strains, develop infection models, and analyze HI_0276 expression during different stages of infection .

How can evolutionary analysis inform our understanding of HI_0276 function?

Evolutionary analysis provides valuable insights into HI_0276 function through these methodological approaches:

Phylogenetic Profiling:

  • Analyze the presence/absence pattern of HI_0276 homologs across species

  • Correlate with phenotypic traits or metabolic capabilities

  • Identify species where HI_0276 is essential versus dispensable

Evolutionary Rate Analysis:

  • Calculate sequence conservation across homologs

  • Identify highly conserved residues likely crucial for function

  • Perform site-specific evolutionary rate analysis to detect:

    • Residues under purifying selection (functionally constrained)

    • Residues under positive selection (potential host adaptation sites)

Coevolution Analysis:

  • Identify coevolving residue networks within the protein

  • Detect residues with correlated mutational patterns suggesting:

    • Structural contacts

    • Functional coupling

    • Allosteric networks

Evolutionary Couplings with Other Proteins:

  • Identify genes that show similar evolutionary patterns

  • Detect potential interaction partners through mirrortree analysis

  • Analyze gene neighborhood conservation across genomes

Domain Architecture Analysis:

  • Compare domain organization with homologs from diverse species

  • Identify domain fusion/fission events that suggest functional associations

  • Detect lineage-specific insertions or deletions with functional implications

By integrating these evolutionary analyses, researchers can generate specific hypotheses about HI_0276 function and identify key residues for mutagenesis studies .

What are the challenges and solutions in reconstituting HI_0276 for functional studies?

Reconstituting membrane proteins like HI_0276 for functional studies presents several challenges that require specific methodological solutions:

Challenges and Solutions in Membrane Protein Reconstitution:

ChallengeSolution ApproachesMethodological Details
Maintaining native conformationLipid nanodisc technologyIncorporate protein into MSP1D1-scaffolded nanodiscs with E. coli polar lipids
Low reconstitution efficiencyDetergent screeningSystematic testing of detergents (DDM, OG, LDAO) for optimal solubilization and reconstitution
Functional assessmentDevelopment of activity assaysDesign assays based on predicted function (transport, signaling, or enzymatic)
Orientation control in liposomesAsymmetric reconstitutionUse pH gradients or electrochemical potential to drive directional insertion
Aggregation during reconstitutionStabilizing additivesInclude glycerol (10%), cholesterol hemisuccinate, or specific lipids during reconstitution
Verification of proper foldingBiophysical characterizationEmploy circular dichroism, fluorescence spectroscopy, and limited proteolysis
Low protein yieldScale-up strategiesOptimize expression conditions and develop high-yield purification protocols

Reconstitution Protocol Optimization:

  • Detergent Selection: Test multiple detergents for HI_0276 solubilization

  • Lipid Composition: Determine optimal lipid mixtures that support protein function

  • Protein:Lipid Ratio: Optimize ratios to prevent aggregation and ensure functionality

  • Removal of Detergent: Compare methods (dialysis, Bio-Beads, cyclodextrin) for effectiveness

  • Functional Verification: Develop assays to confirm proper reconstitution and activity

These approaches allow researchers to overcome the inherent difficulties in working with membrane proteins like HI_0276 and establish reliable functional assay systems .

How do contradictory experimental results for HI_0276 function get resolved in research?

Resolving contradictory results in HI_0276 functional studies requires a systematic troubleshooting approach:

Methodological Standardization:

  • Develop standardized protocols for expression and purification

  • Establish consistent assay conditions across laboratories

  • Create reference standards for activity measurements

  • Implement detailed reporting of experimental conditions

Cross-Validation with Multiple Techniques:

  • Apply orthogonal methods to verify findings

  • Confirm in vitro results with in vivo experiments

  • Validate biochemical data with genetic approaches

  • Supplement functional data with structural information

Identification of Variable Factors:

  • Analyze effects of different detergents on protein behavior

  • Test influence of lipid composition on activity

  • Examine potential post-translational modifications

  • Assess the impact of experimental buffer conditions

Collaborative Resolution Approaches:

  • Organize multi-laboratory studies using identical materials

  • Establish data sharing platforms for raw experimental data

  • Develop consensus protocols through research networks

  • Implement blinded experimental designs for critical experiments

Computational Integration of Contradictory Data:

  • Apply Bayesian analysis to weigh conflicting evidence

  • Develop models that might explain seemingly contradictory results

  • Use machine learning to identify patterns in contradictory datasets

  • Employ systems biology approaches to place contradictory results in context

Case Study Approach for Resolution:

  • Document specific examples where contradictions were successfully resolved

  • Identify common sources of experimental variability

  • Develop decision trees for troubleshooting contradictory results

  • Create repositories of negative and conflicting data

This systematic approach helps researchers navigate the challenges of studying novel membrane proteins like HI_0276, where function assignment is still evolving .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.